BS24645.complete Sequence
242 bp assembled on 2011-06-23
GenBank Submission: KX805677
> BS24645.complete
GAAGTTATCAGTCGACATGGAAATCAAGTTCCTAATTGTCCTGTCCGCTG
TCTTGATGATAATTTTCCTGGGAGCGGAAGAATCACATGCCGACTGCCTT
TCCGGAAGATATAGGGGTTCCTGTGCTGTGTGGCACAGGAAGAAGTGCGT
AGATATCTGCCAGAGGGAAGGGCGAACCAGTGGACACTGCAGCCCCAGTC
TAAAATGCTGGTGCGAAGGATGCTAAAAGCTTTCTAGACCAT
BS24645.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:44:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl1-RA | 210 | CG32274-PA | 1..210 | 17..226 | 1050 | 100 | Plus |
| Drs-RA | 213 | CG10810-PA | 33..213 | 46..226 | 260 | 76.2 | Plus |
| Drsl2-RA | 213 | CG32279-PA | 74..211 | 87..224 | 210 | 76.8 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:44:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl1-RA | 210 | CG32274-RA | 1..210 | 17..226 | 1050 | 100 | Plus |
| Drs-RA | 387 | CG10810-RA | 96..277 | 46..227 | 265 | 76.4 | Plus |
| Drsl2-RA | 333 | CG32279-RA | 100..237 | 87..224 | 210 | 76.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:44:30
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 3335577..3335788 | 228..17 | 1060 | 100 | Minus |
| 3L | 28110227 | 3L | 3369651..3369832 | 46..227 | 265 | 76.4 | Plus |
| 3L | 28110227 | 3L | 3314448..3314585 | 87..224 | 210 | 76.8 | Plus |
| 3L | 28110227 | 3L | 3316984..3317043 | 166..225 | 195 | 88.3 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:44:31 has no hits.
BS24645.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-23 12:02:23 Download gff for
BS24645.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drs-l-RA | 1..208 | 17..224 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:57:11 Download gff for
BS24645.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl1-RA | 1..208 | 17..224 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:17 Download gff for
BS24645.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Drsl1-RA | 1..208 | 17..224 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:17 Download gff for
BS24645.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 3335581..3335788 | 17..224 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:57:11 Download gff for
BS24645.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 3335581..3335788 | 17..224 | 100 | | Minus |
BS24645.pep Sequence
Translation from 16 to 225
> BS24645.pep
MEIKFLIVLSAVLMIIFLGAEESHADCLSGRYRGSCAVWHRKKCVDICQR
EGRTSGHCSPSLKCWCEGC*
BS24645.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:35:15
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Drsl1-PA | 69 | CG32274-PA | 1..69 | 1..69 | 386 | 100 | Plus |
| Drs-PA | 70 | CG10810-PA | 2..70 | 1..69 | 278 | 66.7 | Plus |
| Drsl5-PA | 69 | CG10812-PA | 1..69 | 1..69 | 266 | 65.2 | Plus |
| Drsl2-PA | 70 | CG32279-PA | 2..70 | 1..69 | 249 | 60.9 | Plus |
| Drsl6-PA | 72 | CG32268-PA | 2..72 | 1..69 | 247 | 60.6 | Plus |
