BS24685.complete Sequence
185 bp assembled on 2011-06-21
GenBank Submission: KX801917
> BS24685.complete
GAAGTTATCAGTCGACATGCATTTCTATCATTTAAATGCGCTTTGCGTGA
TTATTTTATTAGATTTGACCAACGCGTTGAATCCAAAGGAAGGATCTACT
TTTTGTGTACCTAACTATAGAGGATGGTGCTGGGATAGCAATGCGAATGT
TTGGACCTACGGAAGATAGAAGCTTTCTAGACCAT
BS24685.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:14:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A2-RA | 153 | CG42473-PA | 1..153 | 17..169 | 765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:14:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A2-RA | 337 | CG42473-RA | 16..170 | 16..170 | 775 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:14:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11837728..11837882 | 16..170 | 775 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 15:14:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
GATE | 8507 | GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). | 383..475 | 112..21 | 102 | 58.1 | Minus |
BS24685.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:29:22 Download gff for
BS24685.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 17..169 | 17..169 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:07 Download gff for
BS24685.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 17..169 | 17..169 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:14 Download gff for
BS24685.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A2-RA | 17..169 | 17..169 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:14 Download gff for
BS24685.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837729..11837881 | 17..169 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:07 Download gff for
BS24685.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11837729..11837881 | 17..169 | 100 | | Plus |
BS24685.pep Sequence
Translation from 16 to 168
> BS24685.pep
MHFYHLNALCVIILLDLTNALNPKEGSTFCVPNYRGWCWDSNANVWTYGR
*
BS24685.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A2-PA | 50 | CG42473-PA | 1..50 | 1..50 | 293 | 100 | Plus |
Sfp33A4-PA | 50 | CG42604-PA | 1..50 | 1..50 | 138 | 48 | Plus |