Clone BS24685 Report

Search the DGRC for BS24685

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:246
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptSfp33A2-RA
Protein status:BS24685.pep: full length peptide match
Sequenced Size:185

Clone Sequence Records

BS24685.complete Sequence

185 bp assembled on 2011-06-21

GenBank Submission: KX801917

> BS24685.complete
GAAGTTATCAGTCGACATGCATTTCTATCATTTAAATGCGCTTTGCGTGA
TTATTTTATTAGATTTGACCAACGCGTTGAATCCAAAGGAAGGATCTACT
TTTTGTGTACCTAACTATAGAGGATGGTGCTGGGATAGCAATGCGAATGT
TTGGACCTACGGAAGATAGAAGCTTTCTAGACCAT

BS24685.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A2-RA 153 CG42473-PA 1..153 17..169 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A2-RA 337 CG42473-RA 16..170 16..170 775 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11837728..11837882 16..170 775 100 Plus
Blast to na_te.dros performed 2014-11-26 15:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 383..475 112..21 102 58.1 Minus

BS24685.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:29:22 Download gff for BS24685.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..169 17..169 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:07 Download gff for BS24685.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..169 17..169 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:14 Download gff for BS24685.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A2-RA 17..169 17..169 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:14 Download gff for BS24685.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837729..11837881 17..169 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:07 Download gff for BS24685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11837729..11837881 17..169 100   Plus

BS24685.pep Sequence

Translation from 16 to 168

> BS24685.pep
MHFYHLNALCVIILLDLTNALNPKEGSTFCVPNYRGWCWDSNANVWTYGR
*

BS24685.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A2-PA 50 CG42473-PA 1..50 1..50 293 100 Plus
Sfp33A4-PA 50 CG42604-PA 1..50 1..50 138 48 Plus