Clone BS24691 Report

Search the DGRC for BS24691

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:246
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptDup99B-RA
Protein status:BS24691.pep: full length peptide match
Sequenced Size:197

Clone Sequence Records

BS24691.complete Sequence

197 bp assembled on 2011-06-21

GenBank Submission: KX805523

> BS24691.complete
GAAGTTATCAGTCGACATGAAGACTCCGCTATTTCTCCTCTTGGTCGTAT
TGGCTTCCCTCCTGGGATTGGCCTTATCCCAGGATCGAAATGATACGGAG
TGGATCCAAAGTCAGAAGGATCGTGAGAAGTGGTGCCGGCTAAACTTAGG
ACCCTACCTCGGTGGCAGATGCCGAAAATAAAAGCTTTCTAGACCAT

BS24691.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dup99B-RA 165 CG33495-PA 1..165 17..181 825 100 Plus
Dup99B-RB 114 CG33495-PB 1..111 17..127 555 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dup99B-RA 257 CG33495-RA 28..193 16..181 830 100 Plus
Dup99B-RB 310 CG33495-RB 28..143 16..131 565 99.1 Plus
Dup99B-RB 310 CG33495-RB 188..246 123..181 295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29715235..29715350 131..16 565 99.1 Minus
3R 32079331 3R 29715132..29715190 181..123 295 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:14:27 has no hits.

BS24691.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:29:23 Download gff for BS24691.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 29..191 17..179 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:10 Download gff for BS24691.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 29..191 17..179 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:20 Download gff for BS24691.complete
Subject Subject Range Query Range Percent Splice Strand
Dup99B-RA 29..191 17..179 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:20 Download gff for BS24691.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29715134..29715190 123..179 100 <- Minus
3R 29715244..29715349 17..122 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:10 Download gff for BS24691.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25540856..25540912 123..179 100 <- Minus
arm_3R 25540966..25541071 17..122 100   Minus

BS24691.pep Sequence

Translation from 16 to 180

> BS24691.pep
MKTPLFLLLVVLASLLGLALSQDRNDTEWIQSQKDREKWCRLNLGPYLGG
RCRK*

BS24691.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dup99B-PA 54 CG33495-PA 1..54 1..54 286 100 Plus
Dup99B-PB 37 CG33495-PB 1..37 1..37 182 100 Plus