BS24691.complete Sequence
197 bp assembled on 2011-06-21
GenBank Submission: KX805523
> BS24691.complete
GAAGTTATCAGTCGACATGAAGACTCCGCTATTTCTCCTCTTGGTCGTAT
TGGCTTCCCTCCTGGGATTGGCCTTATCCCAGGATCGAAATGATACGGAG
TGGATCCAAAGTCAGAAGGATCGTGAGAAGTGGTGCCGGCTAAACTTAGG
ACCCTACCTCGGTGGCAGATGCCGAAAATAAAAGCTTTCTAGACCAT
BS24691.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:14:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dup99B-RA | 165 | CG33495-PA | 1..165 | 17..181 | 825 | 100 | Plus |
Dup99B-RB | 114 | CG33495-PB | 1..111 | 17..127 | 555 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:14:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dup99B-RA | 257 | CG33495-RA | 28..193 | 16..181 | 830 | 100 | Plus |
Dup99B-RB | 310 | CG33495-RB | 28..143 | 16..131 | 565 | 99.1 | Plus |
Dup99B-RB | 310 | CG33495-RB | 188..246 | 123..181 | 295 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:14:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 29715235..29715350 | 131..16 | 565 | 99.1 | Minus |
3R | 32079331 | 3R | 29715132..29715190 | 181..123 | 295 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:14:27 has no hits.
BS24691.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:29:23 Download gff for
BS24691.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 29..191 | 17..179 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:10 Download gff for
BS24691.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 29..191 | 17..179 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:20 Download gff for
BS24691.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dup99B-RA | 29..191 | 17..179 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:20 Download gff for
BS24691.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29715134..29715190 | 123..179 | 100 | <- | Minus |
3R | 29715244..29715349 | 17..122 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:10 Download gff for
BS24691.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25540856..25540912 | 123..179 | 100 | <- | Minus |
arm_3R | 25540966..25541071 | 17..122 | 100 | | Minus |
BS24691.pep Sequence
Translation from 16 to 180
> BS24691.pep
MKTPLFLLLVVLASLLGLALSQDRNDTEWIQSQKDREKWCRLNLGPYLGG
RCRK*
BS24691.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dup99B-PA | 54 | CG33495-PA | 1..54 | 1..54 | 286 | 100 | Plus |
Dup99B-PB | 37 | CG33495-PB | 1..37 | 1..37 | 182 | 100 | Plus |