Clone BS24695 Report

Search the DGRC for BS24695

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:246
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCpr65Ax1-RA
Protein status:BS24695.pep: full length peptide match
Sequenced Size:341

Clone Sequence Records

BS24695.complete Sequence

341 bp assembled on 2011-09-14

GenBank Submission: KX804420

> BS24695.complete
GAAGTTATCAGTCGACATGAAATTCGCCATCGTCCTGTTCGCCCTCTTTG
CCGTGGCCCTGGCTGCCCCTACTGTCGAGGTCCTGCGATCGGATAGCAAT
GTTGGAATCGATAACTACTCATATGCAGTTGAAACCAGCGACGGTACCTC
GAAGAGCGAGGAGGGTGTGCTGAAGAACGCCGGCACCGAGCTAGAGGCCA
TCTCAACCCACGGCTCCTTCAGCTACGTGGGCCCTGATGGCCAGACCTAC
ACCGTCACCTACGTGGCCGATGAGAACGGATTCCAGCCCCAGGGTGCTCA
TCTGCCCGTTGCCCCCGTTGCCTAAAAGCTTTCTAGACCAT

BS24695.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ax1-RA 309 CG34270-PA 1..309 17..325 1545 100 Plus
Cpr65Ax2-RB 309 CG18777-PB 1..309 17..325 1545 100 Plus
Cpr65Ax2-RA 309 CG18777-PA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ax1-RA 389 CG34270-RA 49..357 17..325 1545 100 Plus
Cpr65Ax2-RB 732 CG18777-RB 48..356 17..325 1545 100 Plus
Cpr65Ax2-RA 388 CG18777-RA 48..356 17..325 1545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6147563..6147761 325..127 995 100 Minus
3L 28110227 3L 6150434..6150632 325..127 995 100 Minus
3L 28110227 3L 6147830..6147939 126..17 550 100 Minus
3L 28110227 3L 6150701..6150810 126..17 550 100 Minus
3L 28110227 3L 6133154..6133244 325..235 335 91.2 Minus
3L 28110227 3L 6134835..6134925 325..235 320 90.1 Minus
3L 28110227 3L 6130551..6130641 325..235 305 89 Minus
3L 28110227 3L 6145140..6145289 158..307 300 80 Plus
3L 28110227 3L 6137725..6137830 313..208 290 84.9 Minus
3L 28110227 3L 6136387..6136470 318..235 270 88.1 Minus
3L 28110227 3L 6146961..6147036 250..325 230 86.8 Plus
3L 28110227 3L 6149832..6149907 250..325 230 86.8 Plus
3L 28110227 3L 6139425..6139574 307..158 225 76.7 Minus
3L 28110227 3L 6143800..6143871 236..307 195 84.7 Plus
3L 28110227 3L 6151536..6151619 211..294 180 81 Plus
2R 25286936 2R 12408286..12408333 259..306 180 91.7 Plus
Blast to na_te.dros performed on 2014-11-27 07:24:42 has no hits.

BS24695.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:28 Download gff for BS24695.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ax1-RA 46..352 17..323 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:26 Download gff for BS24695.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ax1-RA 49..355 17..323 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:05 Download gff for BS24695.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ax2-RA 48..354 17..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:05 Download gff for BS24695.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6147565..6147761 127..323 100 <- Minus
3L 6147830..6147939 17..126 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:26 Download gff for BS24695.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6140665..6140861 127..323 100 <- Minus
arm_3L 6140930..6141039 17..126 100   Minus

BS24695.pep Sequence

Translation from 16 to 324

> BS24695.pep
MKFAIVLFALFAVALAAPTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEG
VLKNAGTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAP
VA*

BS24695.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ax1-PA 102 CG34270-PA 1..102 1..102 515 100 Plus
Cpr65Ax2-PB 102 CG18777-PB 1..102 1..102 515 100 Plus
Cpr65Ax2-PA 102 CG18777-PA 1..102 1..102 515 100 Plus
Lcp65Ag1-PA 105 CG10530-PA 1..105 1..102 309 60 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..105 1..102 309 60 Plus