Clone BS24704 Report

Search the DGRC for BS24704

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG10320-RA
Protein status:BS24704.pep: full length peptide match
Sequenced Size:365

Clone Sequence Records

BS24704.complete Sequence

365 bp assembled on 2011-06-21

GenBank Submission: KX805939

> BS24704.complete
GAAGTTATCAGTCGACATGGGCGGACATCACGGCGAACCCTACACGGTGC
CCCACGCATCGACCTACAAGGTGGAGAGTGTGCCCCAACTCGTGGAGGTG
AAGGAGGCTCTGGGCCGCCAGGGATTGAAGGATCCATGGCTGAGGAACGA
AGTCTGGCGCTATGAGCCCAAGGCCTTCGGCACCCACAGATCCCGCCTGA
ACACCTTCCTTTTCCGCGGACTCGGCGTGGGATTCTGCGCTTTCCTGGCC
ACCGTCGCCGTGGAGTACGCGCTGGGCATTGGCAAGGGTCAGGGCGGCCA
TGGACATGGCCACGGTCACGAGGAACACGGAGATAAGGGCCACCATTAGA
AGCTTTCTAGACCAT

BS24704.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG10320-RE 333 CG10320-PE 1..333 17..349 1665 100 Plus
CG10320-RD 333 CG10320-PD 1..333 17..349 1665 100 Plus
CG10320-RC 333 CG10320-PC 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10320-RE 405 CG10320-RE 40..373 17..350 1670 100 Plus
CG10320-RD 525 CG10320-RD 160..493 17..350 1670 100 Plus
CG10320-RC 520 CG10320-RC 155..488 17..350 1670 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21658538..21658745 143..350 1040 100 Plus
2R 25286936 2R 21658353..21658481 17..145 645 100 Plus
Blast to na_te.dros performed 2014-11-26 15:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 354..395 80..121 102 71.4 Plus

BS24704.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 11:27:00 Download gff for BS24704.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RE 43..375 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:51:11 Download gff for BS24704.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RC 155..487 17..349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:42 Download gff for BS24704.complete
Subject Subject Range Query Range Percent Splice Strand
CG10320-RC 155..487 17..349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:42 Download gff for BS24704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21658353..21658480 17..144 100 -> Plus
2R 21658540..21658744 145..349 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:51:11 Download gff for BS24704.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17545858..17545985 17..144 100 -> Plus
arm_2R 17546045..17546249 145..349 100   Plus

BS24704.pep Sequence

Translation from 16 to 348

> BS24704.pep
MGGHHGEPYTVPHASTYKVESVPQLVEVKEALGRQGLKDPWLRNEVWRYE
PKAFGTHRSRLNTFLFRGLGVGFCAFLATVAVEYALGIGKGQGGHGHGHG
HEEHGDKGHH*

BS24704.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG10320-PE 110 CG10320-PE 1..110 1..110 616 100 Plus
CG10320-PD 110 CG10320-PD 1..110 1..110 616 100 Plus
CG10320-PC 110 CG10320-PC 1..110 1..110 616 100 Plus
CG10320-PB 110 CG10320-PB 1..110 1..110 616 100 Plus
CG10320-PA 110 CG10320-PA 1..110 1..110 616 100 Plus