Clone BS24712 Report

Search the DGRC for BS24712

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCp16-RA
Protein status:BS24712.pep: full length peptide match
Sequenced Size:449

Clone Sequence Records

BS24712.complete Sequence

449 bp assembled on 2011-06-17

GenBank Submission: KX806418

> BS24712.complete
GAAGTTATCAGTAGACATGTCCGCCACCCTACGTCTTCTCTGCCTGATGG
CCTGCTGCGTCGCCCTGGCTGTGGCCAATCGCCCCAACTACGGCGGATCC
GGATACGGAGCCAGCTACGGCGATGTGGTTAAGGCCGCTGAGACCGCCGA
GGCTCAGGCTTCTGCCCTGACCAACGCTGCCGGAGCAGCTGCCTCCGCCG
CCAAGCTGGACGGTGCTGACTGGAATTCCCTCAACCGTTATGGATGGGAG
CAGGGTCGCCCACTTTTGGCCAAGCCCTACGGCCCTCTGGACCCGCTATA
CGCTGCTGCTCTGCCACCACGCTCCTTCGTGGCTGAGGTCGATCCAGTCT
TCAAGAAGAGCCAATACGGCGGATCTTACGGCGAGAATGCGTACCTGAAG
ACCGACGCCAAACTGGGTGTTGTGGCCATCTAAAAGCTTTCTAGACCAT

BS24712.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
Cp16-RA 417 CG6533-PA 1..417 17..433 2085 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
Cp16-RA 522 CG6533-RA 48..470 17..439 2100 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8731991..8732321 17..347 1655 100 Plus
3L 28110227 3L 8732453..8732547 345..439 460 98.9 Plus
Blast to na_te.dros performed on 2014-11-26 14:42:59 has no hits.

BS24712.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:12 Download gff for BS24712.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 250..664 17..431 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:41:05 Download gff for BS24712.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 48..462 17..431 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:58:53 Download gff for BS24712.complete
Subject Subject Range Query Range Percent Splice Strand
Cp16-RA 48..462 17..431 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:58:53 Download gff for BS24712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8731991..8732321 17..347 100 -> Plus
3L 8732456..8732539 348..431 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:41:05 Download gff for BS24712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8725091..8725421 17..347 100 -> Plus
arm_3L 8725556..8725639 348..431 100   Plus

BS24712.pep Sequence

Translation from 16 to 432

> BS24712.pep
MSATLRLLCLMACCVALAVANRPNYGGSGYGASYGDVVKAAETAEAQASA
LTNAAGAAASAAKLDGADWNSLNRYGWEQGRPLLAKPYGPLDPLYAAALP
PRSFVAEVDPVFKKSQYGGSYGENAYLKTDAKLGVVAI*

BS24712.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Cp16-PA 138 CG6533-PA 1..138 1..138 714 100 Plus