Clone BS24727 Report

Search the DGRC for BS24727

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG14187-RA
Protein status:BS24727.pep: gold
Sequenced Size:413

Clone Sequence Records

BS24727.complete Sequence

413 bp assembled on 2011-06-17

GenBank Submission: KX800264

> BS24727.complete
GAAGTTATCAGTCGACATGGGAGACGACAACCAGCGATTCCAATTCCAAC
TGCAGGCAGTGGCAACAGTTTTCTTGTTGGTTTCACAGCTTTGCTTTGCC
CTGCCCTTTGCATCTTCCACCGGAAACGATATAGAAAACGATGGGAACAT
TCAGAATTCGGCCAGTGGACGACCTGTGGATTATCACACGGTGGTGGGCC
ACTTCAAGGACTTCTTCATGTACCTGCCGGTGATGATGACCACGCTGAAG
GAGACGATGTCAGGATTCCCCAAGTTCGCCGAGGGCATGCGCATCCTGAC
TTCTGGCAAAGGACGAGTGGACGGCGAGGATTGCAAGTGCAGCCAAAATG
CATTGGCCAGCGGCGAACTCTTGGACACCAATTCTCGCTTCGGTTGAAAG
CTTTCTAGACCAT

BS24727.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14187-RA 381 CG14187-PA 1..381 17..397 1905 100 Plus
CG14187-RB 327 CG14187-PB 64..327 134..397 1320 100 Plus
CG14187-RB 327 CG14187-PB 1..64 17..80 320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14187-RA 492 CG14187-RA 22..403 16..397 1910 100 Plus
CG14187-RB 438 CG14187-RB 86..349 134..397 1320 100 Plus
CG14187-RB 438 CG14187-RB 22..86 16..80 325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20112354..20112671 397..80 1590 100 Minus
3L 28110227 3L 20112762..20112826 80..16 325 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:44:11 has no hits.

BS24727.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:20 Download gff for BS24727.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 23..402 17..396 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:41:29 Download gff for BS24727.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 23..402 17..396 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:13 Download gff for BS24727.complete
Subject Subject Range Query Range Percent Splice Strand
CG14187-RA 23..402 17..396 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:13 Download gff for BS24727.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20112355..20112670 81..396 100 <- Minus
3L 20112762..20112825 17..80 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:41:29 Download gff for BS24727.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20105455..20105770 81..396 100 <- Minus
arm_3L 20105862..20105925 17..80 100   Minus

BS24727.pep Sequence

Translation from 16 to 396

> BS24727.pep
MGDDNQRFQFQLQAVATVFLLVSQLCFALPFASSTGNDIENDGNIQNSAS
GRPVDYHTVVGHFKDFFMYLPVMMTTLKETMSGFPKFAEGMRILTSGKGR
VDGEDCKCSQNALASGELLDTNSRFG*

BS24727.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25211-PA 118 GF25211-PA 9..118 13..126 472 77.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13345-PA 126 GG13345-PA 1..126 1..126 613 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16352-PA 129 GH16352-PA 3..128 4..125 442 69.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14187-PA 126 CG14187-PA 1..126 1..126 659 100 Plus
CG14187-PB 108 CG14187-PB 1..108 1..126 538 85.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11545-PA 127 GI11545-PA 21..127 26..126 411 75 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24839-PA 439 GL24839-PA 330..439 22..126 406 73.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12815-PA 128 GA12815-PA 4..128 3..126 454 70.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22251-PA 126 GM22251-PA 1..126 1..126 666 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12223-PA 126 GD12223-PA 1..126 1..126 666 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11564-PA 128 GJ11564-PA 7..127 11..125 427 68.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17044-PA 127 GK17044-PA 2..127 11..126 431 72.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22758-PA 125 GE22758-PA 1..125 1..126 612 92.9 Plus
Dyak\GE22435-PA 125 GE22435-PA 1..125 1..126 612 92.9 Plus