Clone BS24748 Report

Search the DGRC for BS24748

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptVm26Ab-RA
Protein status:BS24748.pep: gold
Sequenced Size:539

Clone Sequence Records

BS24748.complete Sequence

539 bp assembled on 2011-06-17

GenBank Submission: KX804095

> BS24748.complete
GAAGTTATCAGTCGACATGGCATTCAACTTTGGTCACCTCCTCATCGCCG
GCCTCGTGGCCTTGTCCGCCGTGTCCTCGGAGACCATCCAGCTGCAGCCC
ACTCAGGGCATCCTCATCCCCGCCCCGCTGGCCGAGAACATCCGTGTGTC
GCGTGCCGCCTACGGAGGATACGGCGCTGCCCCAGCCGCCCCATCGTACT
CCGCCCCAGCCGCTCCCGCTGCCCAGGCCTACTCTGCTCCCGCTGCCCCA
GCCTACTCCGCACCCGCTGCTCCCGCCTACTCCGCACCCGCTGCTCCTGC
CTACTCTGCTCCCGCTGCCCCAGCTTACTCTGCCCCAGCCGCACCAGCTT
ACTCCGCACCCGCCTCCATTCCGTCGCCGCCGTGCCCCAAGAACTACCTG
TTCAGCTGCCAGCCCTCCCTGCAGCCCGTGCCCTGCTCCGCCCCAGCTCA
GTCCTACGGATCCGCCGGTGCCTACTCCCAGTACGTGCCCCAGTACGCCG
TGCCCTTCGTCCGCGAACTTTAAAAGCTTTCTAGACCAT

BS24748.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
Vm26Ab-RB 507 CG9046-PB 1..507 17..523 2535 100 Plus
Vm26Ab-RA 507 CG9046-PA 1..507 17..523 2535 100 Plus
Vm26Ab-RB 507 CG9046-PB 196..324 236..364 360 85.3 Plus
Vm26Ab-RB 507 CG9046-PB 220..348 212..340 360 85.3 Plus
Vm26Ab-RA 507 CG9046-PA 196..324 236..364 360 85.3 Plus
Vm26Ab-RA 507 CG9046-PA 220..348 212..340 360 85.3 Plus
Vm34Ca-RA 360 CG9271-PA 194..325 354..485 300 81.8 Plus
Vm26Ab-RB 507 CG9046-PB 194..275 282..363 230 85.4 Plus
Vm26Ab-RB 507 CG9046-PB 266..347 210..291 230 85.4 Plus
Vm26Ab-RA 507 CG9046-PA 194..275 282..363 230 85.4 Plus
Vm26Ab-RA 507 CG9046-PA 266..347 210..291 230 85.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Vm26Ab-RB 636 CG9046-RB 63..569 17..523 2535 100 Plus
Vm26Ab-RA 625 CG9046-RA 63..569 17..523 2535 100 Plus
Vm26Ab-RB 636 CG9046-RB 258..386 236..364 360 85.3 Plus
Vm26Ab-RB 636 CG9046-RB 282..410 212..340 360 85.3 Plus
Vm26Ab-RA 625 CG9046-RA 258..386 236..364 360 85.3 Plus
Vm26Ab-RA 625 CG9046-RA 282..410 212..340 360 85.3 Plus
Vm34Ca-RA 491 CG9271-RA 240..371 354..485 300 81.8 Plus
Vm26Ab-RB 636 CG9046-RB 256..337 282..363 230 85.4 Plus
Vm26Ab-RB 636 CG9046-RB 328..409 210..291 230 85.4 Plus
Vm26Ab-RA 625 CG9046-RA 256..337 282..363 230 85.4 Plus
Vm26Ab-RA 625 CG9046-RA 328..409 210..291 230 85.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5957066..5957572 17..523 2535 100 Plus
2L 23513712 2L 5957261..5957389 236..364 360 85.3 Plus
2L 23513712 2L 5957285..5957413 212..340 360 85.3 Plus
2L 23513712 2L 13411261..13411392 485..354 300 81.8 Minus
2L 23513712 2L 5959936..5960031 478..383 255 84.4 Minus
2L 23513712 2L 5957259..5957340 282..363 230 85.4 Plus
2L 23513712 2L 5957331..5957412 210..291 230 85.4 Plus
Blast to na_te.dros performed 2014-11-26 14:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 10408..10496 375..289 108 63 Minus

BS24748.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:21 Download gff for BS24748.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Ab-RA 63..567 17..521 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:41:35 Download gff for BS24748.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Ab-RA 63..567 17..521 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:18 Download gff for BS24748.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Ab-RA 63..567 17..521 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:18 Download gff for BS24748.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5957066..5957570 17..521 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:41:35 Download gff for BS24748.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5957066..5957570 17..521 100   Plus

BS24748.pep Sequence

Translation from 1 to 522

> BS24748.pep
KLSVDMAFNFGHLLIAGLVALSAVSSETIQLQPTQGILIPAPLAENIRVS
RAAYGGYGAAPAAPSYSAPAAPAAQAYSAPAAPAYSAPAAPAYSAPAAPA
YSAPAAPAYSAPAAPAYSAPASIPSPPCPKNYLFSCQPSLQPVPCSAPAQ
SYGSAGAYSQYVPQYAVPFVREL*

BS24748.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15591-PA 163 GF15591-PA 113..163 123..173 250 96.1 Plus
Dana\GF21650-PA 118 GF21650-PA 68..112 122..166 194 86.7 Plus
Dana\GF14293-PA 147 GF14293-PA 77..127 123..168 158 70.6 Plus
Dana\GF15128-PA 105 GF15128-PA 24..68 121..165 155 64.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25107-PA 174 GG25107-PA 124..174 123..173 264 100 Plus
Dere\GG10199-PA 119 GG10199-PA 68..113 121..166 193 84.8 Plus
Dere\GG24269-PA 142 GG24269-PA 72..117 123..168 169 78.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11015-PA 170 GH11015-PA 124..169 128..173 224 93.5 Plus
Dgri\GH11097-PA 106 GH11097-PA 55..100 121..166 188 82.6 Plus
Dgri\GH10720-PA 130 GH10720-PA 62..107 123..168 171 76.1 Plus
Dgri\GH10719-PA 144 GH10719-PA 76..121 123..168 166 71.7 Plus
Dgri\GH24704-PA 692 GH24704-PA 449..522 59..121 142 66.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Vm26Ab-PB 168 CG9046-PB 1..168 6..173 866 100 Plus
Vm26Ab-PA 168 CG9046-PA 1..168 6..173 866 100 Plus
Vm34Ca-PA 119 CG9271-PA 32..113 55..166 302 58.9 Plus
Vml-PB 578 CG34333-PB 154..275 59..168 299 57.7 Plus
Vml-PA 578 CG34333-PA 154..275 59..168 299 57.7 Plus
Vml-PB 578 CG34333-PB 98..212 59..168 292 58.1 Plus
Vml-PB 578 CG34333-PB 320..434 59..168 291 57.5 Plus
Vml-PB 578 CG34333-PB 122..236 59..168 289 57.8 Plus
Vml-PB 578 CG34333-PB 50..180 33..168 288 53.2 Plus
Vml-PB 578 CG34333-PB 344..450 59..168 287 59.5 Plus
Vml-PB 578 CG34333-PB 186..298 59..168 277 56 Plus
Vml-PB 578 CG34333-PB 392..577 59..153 267 39.7 Plus
Vml-PB 578 CG34333-PB 288..426 59..168 258 49.3 Plus
Vml-PB 578 CG34333-PB 218..386 22..168 253 42.1 Plus
Vml-PB 578 CG34333-PB 345..462 41..159 252 51.2 Plus
Vml-PB 578 CG34333-PB 179..314 41..168 223 44.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17534-PA 155 GI17534-PA 109..154 128..173 226 93.5 Plus
Dmoj\GI18220-PA 121 GI18220-PA 71..115 122..166 191 84.4 Plus
Dmoj\GI11326-PA 132 GI11326-PA 62..112 123..168 171 70.6 Plus
Dmoj\GI11336-PA 128 GI11336-PA 58..103 123..168 167 71.7 Plus
Dmoj\GI18145-PA 82 GI18145-PA 13..69 113..166 145 59.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19046-PA 95 GL19046-PA 43..94 122..173 247 92.3 Plus
Dper\GL25706-PA 132 GL25706-PA 82..126 122..166 192 86.7 Plus
Dper\GL19099-PA 147 GL19099-PA 76..126 123..168 171 76.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:54:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21501-PA 177 GA21501-PA 126..176 123..173 247 94.1 Plus
Dpse\GA25403-PA 132 GA25403-PA 82..126 122..166 192 86.7 Plus
Dpse\GA21661-PA 132 GA21661-PA 82..126 122..166 192 86.7 Plus
Dpse\GA21503-PA 147 GA21503-PA 76..126 123..168 171 76.5 Plus
Dpse\GA22863-PA 610 GA22863-PA 10..153 13..121 148 45.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18584-PA 168 GM18584-PA 1..168 6..173 772 100 Plus
Dsec\GM25531-PA 119 GM25531-PA 68..113 121..166 193 84.8 Plus
Dsec\GM17983-PA 141 GM17983-PA 72..122 123..168 171 76.5 Plus
Dsec\GM11107-PA 118 GM11107-PA 21..81 101..165 164 61.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23372-PA 168 GD23372-PA 1..168 6..173 767 99.4 Plus
Dsim\GD22620-PA 141 GD22620-PA 72..122 123..168 171 76.5 Plus
Dsim\GD22183-PA 118 GD22183-PA 38..81 124..165 147 65.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15426-PA 178 GJ15426-PA 127..177 123..173 260 96.1 Plus
Dvir\GJ18127-PA 121 GJ18127-PA 71..116 121..166 183 78.3 Plus
Dvir\GJ12592-PA 133 GJ12592-PA 63..113 123..168 169 74.5 Plus
Dvir\GJ12581-PA 140 GJ12581-PA 70..120 123..168 166 74.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14709-PA 158 GK14709-PA 108..157 123..173 225 90.2 Plus
Dwil\GK15281-PA 111 GK15281-PA 60..105 122..166 184 84.8 Plus
Dwil\GK15410-PA 142 GK15410-PA 71..122 123..168 157 73.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25756-PA 167 GE25756-PA 117..167 123..173 265 100 Plus
Dyak\GE11602-PA 119 GE11602-PA 68..113 121..166 193 84.8 Plus
Dyak\GE18966-PA 141 GE18966-PA 71..116 123..168 162 76.1 Plus
Dyak\GE12948-PA 115 GE12948-PA 41..78 128..165 139 68.4 Plus