Clone BS24749 Report

Search the DGRC for BS24749

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG12824-RB
Protein status:BS24749.pep: gold
Sequenced Size:461

Clone Sequence Records

BS24749.complete Sequence

461 bp assembled on 2011-06-17

GenBank Submission: KX806487

> BS24749.complete
GAAGTTATCAGTCGACATGTGGAAACCGGACTCCAAGGCGGGCATTATTT
GCTCCGGGGCTGCATCGATCTGCCTTGCGATCGCCTACCTCATCATATTC
GCCAACTTGAGGGAATTATCCTACGCATTTGGAGTTCACATAGCGTCCAT
GCAGATTATCAGCAGCGCAGTACTCATCGGCGGAGCCATCAAGGAGAGGC
ACAAGCTCTTCGTGCCCTGGATGATCACAACCGCCATGTTCCTCTACTTA
ATGGGTTACTCATCCATTGTGCTGCTGGCCATGGGCGATTGGTTAATCGT
CATGTTTTGCGCAGCGCCAATGATAGGCTGCCTCGGAATGGCATTCTATG
CGGTGCAGAAGGCCTTCCGCAGGATGCGCAAGGATGGGCTTCCACCGAAG
TATGCCGACATGCAAGTCAAAAGTATTTTGGTGAATCCCATATGAAAGCT
TTCTAGACCAT

BS24749.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12824-RB 429 CG12824-PB 1..429 17..445 2145 100 Plus
CG12824-RA 264 CG12824-PA 1..178 17..194 890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12824-RB 575 CG12824-RB 35..463 17..445 2145 100 Plus
CG12824-RA 692 CG12824-RA 266..519 192..445 1270 100 Plus
CG12824-RA 692 CG12824-RA 35..212 17..194 890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7790691..7790826 192..327 680 100 Plus
2R 25286936 2R 7790877..7790997 325..445 605 100 Plus
2R 25286936 2R 7790402..7790498 17..113 485 100 Plus
2R 25286936 2R 7790556..7790637 113..194 410 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:45:48 has no hits.

BS24749.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:27 Download gff for BS24749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 12..439 17..444 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:04 Download gff for BS24749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 35..462 17..444 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:45 Download gff for BS24749.complete
Subject Subject Range Query Range Percent Splice Strand
CG12824-RB 35..462 17..444 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:45 Download gff for BS24749.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7790879..7790996 327..444 100   Plus
2R 7790402..7790498 17..113 100 -> Plus
2R 7790557..7790636 114..193 100 -> Plus
2R 7790693..7790825 194..326 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:04 Download gff for BS24749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3678062..3678141 114..193 100 -> Plus
arm_2R 3678198..3678330 194..326 100 -> Plus
arm_2R 3678384..3678501 327..444 100   Plus
arm_2R 3677907..3678003 17..113 100 -> Plus

BS24749.pep Sequence

Translation from 16 to 444

> BS24749.pep
MWKPDSKAGIICSGAASICLAIAYLIIFANLRELSYAFGVHIASMQIISS
AVLIGGAIKERHKLFVPWMITTAMFLYLMGYSSIVLLAMGDWLIVMFCAA
PMIGCLGMAFYAVQKAFRRMRKDGLPPKYADMQVKSILVNPI*

BS24749.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13201-PA 144 GF13201-PA 1..144 1..142 342 51 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23302-PA 138 GG23302-PA 1..135 1..138 302 48.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG12824-PB 142 CG12824-PB 1..142 1..142 730 100 Plus
CG12825-PA 144 CG12825-PA 1..144 1..142 327 49 Plus
CG12824-PA 87 CG12824-PA 1..62 1..62 296 96.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10838-PA 142 GL10838-PA 1..142 1..142 270 40.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11836-PA 142 GA11836-PA 1..142 1..142 259 39.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20980-PA 144 GM20980-PA 1..144 1..142 318 49 Plus
Dsec\GM20981-PA 109 GM20981-PA 1..91 1..86 247 59 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15357-PA 142 GD15357-PA 1..142 1..142 666 92.3 Plus
Dsim\GD10509-PA 147 GD10509-PA 1..147 1..142 543 73.1 Plus
Dsim\GD10508-PA 144 GD10508-PA 1..144 1..142 309 48.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21717-PA 144 GK21717-PA 1..144 1..142 225 36.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19148-PA 144 GE19148-PA 1..144 1..142 337 49.7 Plus