Clone BS24760 Report

Search the DGRC for BS24760

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptCG18343-RA
Protein status:BS24760.pep: full length peptide match
Sequenced Size:332

Clone Sequence Records

BS24760.complete Sequence

332 bp assembled on 2011-06-17

GenBank Submission: KX802579

> BS24760.complete
GAAGTTATCAGTCGACATGGAGAAAAGCTGCAGTATTGGCAACGGACGGG
AGCAATACGGCTGGGGACATGGCGAACAATGCGGCACGCAGTTCCTTGAA
TGTGTCTACAGGAACGCGTCCATGTACTCTGTTCTGGGCGATCTGATCAC
ATACGTGGTGTTCCTGGGGGCTACGTGCTACGCAATACTTTTCGGCTTCC
GACTGTTGCTGTCCTGCGTGCGAATCGTCCTCAAAGTGGTTATCGCCCTC
TTCGTCATCCGATTGCTGCTAGCTTTGGGCTCCGTCGACATCACATCTGT
TAGCTATTCCGGGTGAAAGCTTTCTAGACCAT

BS24760.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG18343-RB 300 CG18343-PB 1..300 17..316 1500 100 Plus
CG18343-RA 300 CG18343-PA 1..300 17..316 1500 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG18343-RB 630 CG18343-RB 162..464 15..317 1515 100 Plus
CG18343-RA 449 CG18343-RA 70..372 15..317 1515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12138856..12139158 15..317 1515 100 Plus
Blast to na_te.dros performed 2014-11-26 14:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
diver 6112 diver Tinker 6112bp 2607..2674 178..115 105 66.2 Minus

BS24760.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:27 Download gff for BS24760.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 57..355 17..315 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:02 Download gff for BS24760.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 72..370 17..315 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:44 Download gff for BS24760.complete
Subject Subject Range Query Range Percent Splice Strand
CG18343-RA 72..370 17..315 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:44 Download gff for BS24760.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12138858..12139156 17..315 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:02 Download gff for BS24760.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8026363..8026661 17..315 100   Plus

BS24760.pep Sequence

Translation from 16 to 315

> BS24760.pep
MEKSCSIGNGREQYGWGHGEQCGTQFLECVYRNASMYSVLGDLITYVVFL
GATCYAILFGFRLLLSCVRIVLKVVIALFVIRLLLALGSVDITSVSYSG*

BS24760.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG18343-PB 99 CG18343-PB 1..99 1..99 510 100 Plus
CG18343-PA 99 CG18343-PA 1..99 1..99 510 100 Plus