BS24760.complete Sequence
332 bp assembled on 2011-06-17
GenBank Submission: KX802579
> BS24760.complete
GAAGTTATCAGTCGACATGGAGAAAAGCTGCAGTATTGGCAACGGACGGG
AGCAATACGGCTGGGGACATGGCGAACAATGCGGCACGCAGTTCCTTGAA
TGTGTCTACAGGAACGCGTCCATGTACTCTGTTCTGGGCGATCTGATCAC
ATACGTGGTGTTCCTGGGGGCTACGTGCTACGCAATACTTTTCGGCTTCC
GACTGTTGCTGTCCTGCGTGCGAATCGTCCTCAAAGTGGTTATCGCCCTC
TTCGTCATCCGATTGCTGCTAGCTTTGGGCTCCGTCGACATCACATCTGT
TAGCTATTCCGGGTGAAAGCTTTCTAGACCAT
BS24760.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:45:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18343-RB | 300 | CG18343-PB | 1..300 | 17..316 | 1500 | 100 | Plus |
CG18343-RA | 300 | CG18343-PA | 1..300 | 17..316 | 1500 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:45:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18343-RB | 630 | CG18343-RB | 162..464 | 15..317 | 1515 | 100 | Plus |
CG18343-RA | 449 | CG18343-RA | 70..372 | 15..317 | 1515 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:45:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12138856..12139158 | 15..317 | 1515 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 14:45:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
diver | 6112 | diver Tinker 6112bp | 2607..2674 | 178..115 | 105 | 66.2 | Minus |
BS24760.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:27 Download gff for
BS24760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RA | 57..355 | 17..315 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:02 Download gff for
BS24760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RA | 72..370 | 17..315 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:44 Download gff for
BS24760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG18343-RA | 72..370 | 17..315 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:44 Download gff for
BS24760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12138858..12139156 | 17..315 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:02 Download gff for
BS24760.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8026363..8026661 | 17..315 | 100 | | Plus |
BS24760.pep Sequence
Translation from 16 to 315
> BS24760.pep
MEKSCSIGNGREQYGWGHGEQCGTQFLECVYRNASMYSVLGDLITYVVFL
GATCYAILFGFRLLLSCVRIVLKVVIALFVIRLLLALGSVDITSVSYSG*
BS24760.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG18343-PB | 99 | CG18343-PB | 1..99 | 1..99 | 510 | 100 | Plus |
CG18343-PA | 99 | CG18343-PA | 1..99 | 1..99 | 510 | 100 | Plus |