Clone BS24763 Report

Search the DGRC for BS24763

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptCG31086-RA
Protein status:BS24763.pep: gold
Sequenced Size:479

Clone Sequence Records

BS24763.complete Sequence

479 bp assembled on 2011-06-17

GenBank Submission: KX805740

> BS24763.complete
GAAGTTATCAGTCGACATGGACGGTCACAGCTGGCTTCACTTCAGCAACG
GAGCAATCCCCCAGGCAGCCGTTGTGGCTGGTCACGATTCCGATGGCGAC
ACCATCTTCATTGGCCGCGCCTTCTACTGCAACGACATGCTGCCGGCCAA
GATTATCCCCAACAAGGGCAAGGCCTACGTGGCGTATGCCAACCAGGAGG
TGGAGCTGGAGAACTACGAGGTACTCAGCGGCTTCAACTACGAGTGGCTG
CCGGCCGAGAACGGAGAGGTGCCTCCCGGCGCCGTCAAGGTCGGCCAGAA
TGTCGACGGAGAGACCTTGTACGCCGGAAGGGGCTACCATGCCGGCAGTT
TGACCGTGGGCAAGGTGCATCCGTCCCACGGCTGCCTGTACATTCCCTAC
GATTCCGAGGAGGTTAAGATATTCGCCTACGAGGTTCTGTCCCGTCGCTT
GGAGGCGAGATAGAAGCTTTCTAGACCAT

BS24763.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG31086-RB 447 CG31086-PB 1..447 17..463 2235 100 Plus
CG31086-RA 447 CG31086-PA 1..447 17..463 2235 100 Plus
CG32633-RB 858 CG32633-PB 52..424 68..440 1055 85.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG31086-RB 906 CG31086-RB 401..856 8..463 2250 99.6 Plus
CG31086-RA 527 CG31086-RA 22..477 8..463 2250 99.6 Plus
CG31323-RA 3489 CG31323-RA 1919..2359 23..463 2205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26185737..26186177 23..463 2205 100 Plus
X 23542271 X 13562010..13562382 68..440 1055 85.5 Plus
Blast to na_te.dros performed on 2014-11-26 14:46:39 has no hits.

BS24763.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:30 Download gff for BS24763.complete
Subject Subject Range Query Range Percent Splice Strand
CG31086-RA 23..469 17..463 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:25 Download gff for BS24763.complete
Subject Subject Range Query Range Percent Splice Strand
CG31086-RA 31..477 17..463 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:02 Download gff for BS24763.complete
Subject Subject Range Query Range Percent Splice Strand
CG31086-RA 31..477 17..463 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:02 Download gff for BS24763.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26185732..26186177 17..463 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:25 Download gff for BS24763.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22011454..22011899 17..463 99   Plus

BS24763.pep Sequence

Translation from 16 to 462

> BS24763.pep
MDGHSWLHFSNGAIPQAAVVAGHDSDGDTIFIGRAFYCNDMLPAKIIPNK
GKAYVAYANQEVELENYEVLSGFNYEWLPAENGEVPPGAVKVGQNVDGET
LYAGRGYHAGSLTVGKVHPSHGCLYIPYDSEEVKIFAYEVLSRRLEAR*

BS24763.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG31086-PB 148 CG31086-PB 1..148 1..148 797 100 Plus
CG31086-PA 148 CG31086-PA 1..148 1..148 797 100 Plus
CG32633-PB 285 CG32633-PB 1..141 1..141 664 84.4 Plus
CG32633-PA 285 CG32633-PA 1..141 1..141 664 84.4 Plus
CG32633-PB 285 CG32633-PB 147..284 6..143 430 55.8 Plus
CG32633-PA 285 CG32633-PA 147..284 6..143 430 55.8 Plus
CG13321-PB 286 CG13321-PB 1..142 1..141 417 52.1 Plus
CG32633-PB 285 CG32633-PB 215..282 3..70 153 39.7 Plus
CG32633-PA 285 CG32633-PA 215..282 3..70 153 39.7 Plus
CG32633-PB 285 CG32633-PB 3..71 74..142 151 40.6 Plus
CG32633-PA 285 CG32633-PA 3..71 74..142 151 40.6 Plus