Clone BS24771 Report

Search the DGRC for BS24771

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG14635-RA
Protein status:BS24771.pep: gold
Sequenced Size:392

Clone Sequence Records

BS24771.complete Sequence

392 bp assembled on 2011-06-17

GenBank Submission: KX802145

> BS24771.complete
GAAGTTATCAGTCGACATGTGCTCTAGTTTAAGCGACTTGTTTGCCTGTA
TCAGGGCCCAGGGAAATTCCGACACGGATTCCACCAGCACCACCCATCGG
CGGAATATCGCTGACCTGGACGATGAGGCGCCCGATCTGCAGCTCCAACA
GGAGCAGACCCGCAAGTGGAACGATCTTTCTATGCCACAGCGACACGATT
CGTTTCCAGTTCCTCCTCCTTCAGCTGGATCTCCATCAACGGGCTACCTT
CGTCCCTCATTGCGGTCAGCACGGGTCTCCTACGAAGCCTTGGAGCGCTA
CGATCGAATTTTTGGCAGATCTTTCCAAGACGCCGGGTCATCTGGTTCAG
TTCGAAATATTCCCGACCAGTTCTAGAAGCTTTCTAGACCAT

BS24771.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG14635-RA 360 CG14635-PA 1..360 17..376 1800 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14635-RA 475 CG14635-RA 15..374 17..376 1800 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 844837..845196 17..376 1800 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:46:20 has no hits.

BS24771.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:29 Download gff for BS24771.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..360 17..376 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:16 Download gff for BS24771.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 15..374 17..376 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:55 Download gff for BS24771.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 15..374 17..376 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:55 Download gff for BS24771.complete
Subject Subject Range Query Range Percent Splice Strand
X 844837..845196 17..376 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:16 Download gff for BS24771.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 738870..739229 17..376 100   Plus

BS24771.pep Sequence

Translation from 16 to 375

> BS24771.pep
MCSSLSDLFACIRAQGNSDTDSTSTTHRRNIADLDDEAPDLQLQQEQTRK
WNDLSMPQRHDSFPVPPPSAGSPSTGYLRPSLRSARVSYEALERYDRIFG
RSFQDAGSSGSVRNIPDQF*

BS24771.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14635-PA 119 CG14635-PA 1..119 1..119 624 100 Plus