Clone BS24772 Report

Search the DGRC for BS24772

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptCG15526-RA
Protein status:BS24772.pep: full length peptide match
Sequenced Size:371

Clone Sequence Records

BS24772.complete Sequence

371 bp assembled on 2011-06-17

GenBank Submission: KX806174

> BS24772.complete
GAAGTTATCAGTCGACATGGCGAACTATTACTATTTCGACATCAAACTTA
AACTTCGGGATCCGACTGCAGTTGCTTTGACCCCATCTCTGTTTCGAAGC
TGCGTTCTTGACGCCCTGGACAGTTTCTTCTGCGAGGAGAAACCCACACT
GGAGATCGTGAAGTTCTGCGCCCAGCAACATCGTGTTATCTTTCGAGTGC
CAGAGCAACTGCACGACATGACCCGCATATCCATTGAGCTCATCGGTCAC
TACCAGCAGATACCCTGTCATTTTGAGATCTTGGAAACATCCAAATCATC
GCTGGACTTTGAGAAGAGCATTGAAAAGACTGTCGCGGTTGTGTCCGATG
ATTAGAAGCTTTCTAGACCAT

BS24772.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG15526-RA 339 CG15526-PA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG15526-RA 566 CG15526-RA 179..518 16..355 1700 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30056249..30056555 49..355 1535 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:46:30 has no hits.

BS24772.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:30 Download gff for BS24772.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..339 17..355 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:20 Download gff for BS24772.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 180..518 17..355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:59:59 Download gff for BS24772.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 180..518 17..355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:59 Download gff for BS24772.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30056136..30056167 17..48 100 -> Plus
3R 30056249..30056555 49..355 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:20 Download gff for BS24772.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25881858..25881889 17..48 100 -> Plus
arm_3R 25881971..25882277 49..355 100   Plus

BS24772.pep Sequence

Translation from 16 to 354

> BS24772.pep
MANYYYFDIKLKLRDPTAVALTPSLFRSCVLDALDSFFCEEKPTLEIVKF
CAQQHRVIFRVPEQLHDMTRISIELIGHYQQIPCHFEILETSKSSLDFEK
SIEKTVAVVSDD*

BS24772.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15526-PA 112 CG15526-PA 1..112 1..112 581 100 Plus
CG34317-PA 111 CG34317-PA 1..109 1..107 283 51.4 Plus