BS24775.complete Sequence
254 bp assembled on 2011-06-21
GenBank Submission: KX805391
> BS24775.complete
GAAGTTATCAGTCGACATGAAAGTATATATTTTGATCTGGACAATATTAG
CTCTAACGGCGGATATAAATGGCTTGGTTTGTAATCTTGAACCTTTTGTC
CAAGGATCATGCCTGGAATTGACAGACCTCTATTCCTATGTTGAATATAA
AAACGATTGTGTATACTGGCAGGGATGCCTTCTGAATGGAAATCATTTTA
GCAAAAAAGAGGAGTGCGAAGACATGTGCAAGCAATAAAAGCTTTCTAGA
CCAT
BS24775.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:15:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42465-RA | 222 | CG42465-PA | 1..222 | 17..238 | 1110 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:16:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42465-RA | 401 | CG42465-RA | 51..272 | 17..238 | 1110 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:15:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3700366..3700529 | 75..238 | 820 | 100 | Plus |
2L | 23513712 | 2L | 3700245..3700302 | 17..74 | 290 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:15:57 has no hits.
BS24775.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 11:03:54 Download gff for
BS24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..220 | 17..236 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:26 Download gff for
BS24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 51..270 | 17..236 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:51 Download gff for
BS24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 51..270 | 17..236 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:51 Download gff for
BS24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700366..3700527 | 75..236 | 100 | | Plus |
2L | 3700245..3700302 | 17..74 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:26 Download gff for
BS24775.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3700245..3700302 | 17..74 | 100 | -> | Plus |
arm_2L | 3700366..3700527 | 75..236 | 100 | | Plus |
BS24775.pep Sequence
Translation from 16 to 237
> BS24775.pep
MKVYILIWTILALTADINGLVCNLEPFVQGSCLELTDLYSYVEYKNDCVY
WQGCLLNGNHFSKKEECEDMCKQ*
BS24775.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42465-PA | 73 | CG42465-PA | 1..73 | 1..73 | 407 | 100 | Plus |