Clone BS24775 Report

Search the DGRC for BS24775

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG42465-RA
Protein status:BS24775.pep: gold
Sequenced Size:254

Clone Sequence Records

BS24775.complete Sequence

254 bp assembled on 2011-06-21

GenBank Submission: KX805391

> BS24775.complete
GAAGTTATCAGTCGACATGAAAGTATATATTTTGATCTGGACAATATTAG
CTCTAACGGCGGATATAAATGGCTTGGTTTGTAATCTTGAACCTTTTGTC
CAAGGATCATGCCTGGAATTGACAGACCTCTATTCCTATGTTGAATATAA
AAACGATTGTGTATACTGGCAGGGATGCCTTCTGAATGGAAATCATTTTA
GCAAAAAAGAGGAGTGCGAAGACATGTGCAAGCAATAAAAGCTTTCTAGA
CCAT

BS24775.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG42465-RA 222 CG42465-PA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG42465-RA 401 CG42465-RA 51..272 17..238 1110 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3700366..3700529 75..238 820 100 Plus
2L 23513712 2L 3700245..3700302 17..74 290 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:15:57 has no hits.

BS24775.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 11:03:54 Download gff for BS24775.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..220 17..236 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:50:26 Download gff for BS24775.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 51..270 17..236 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:09:51 Download gff for BS24775.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 51..270 17..236 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:09:51 Download gff for BS24775.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700366..3700527 75..236 100   Plus
2L 3700245..3700302 17..74 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:50:26 Download gff for BS24775.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3700245..3700302 17..74 100 -> Plus
arm_2L 3700366..3700527 75..236 100   Plus

BS24775.pep Sequence

Translation from 16 to 237

> BS24775.pep
MKVYILIWTILALTADINGLVCNLEPFVQGSCLELTDLYSYVEYKNDCVY
WQGCLLNGNHFSKKEECEDMCKQ*

BS24775.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42465-PA 73 CG42465-PA 1..73 1..73 407 100 Plus