BS24776.complete Sequence
182 bp assembled on 2011-06-21
GenBank Submission: KX805110
> BS24776.complete
GAAGTTATCAGTCGACATGAAGTCGCTGCTGTTTTTTCTGTTGGTCATCC
TCTGCCTGGTCGGAATGGCACCAGCCAGGAGAAAGAAAAGGGAGGTCGAG
GTTTGGGTCCGACCAAGTCAAAATTCCTATAACGAGCCATGCTACTATCA
AGGATGCCAACAATGAAAGCTTTCTAGACCAT
BS24776.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:12:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42481-RB | 150 | CG42481-PB | 1..150 | 17..166 | 750 | 100 | Plus |
CG42481-RA | 150 | CG42481-PA | 1..150 | 17..166 | 750 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:12:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42481-RB | 227 | CG42481-RB | 4..153 | 17..166 | 750 | 100 | Plus |
CG42481-RA | 181 | CG42481-RA | 4..153 | 17..166 | 750 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:12:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13298871..13299020 | 166..17 | 750 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:12:53 has no hits.
BS24776.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:23:38 Download gff for
BS24776.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 3..151 | 17..165 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:47 Download gff for
BS24776.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 4..152 | 17..165 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:47 Download gff for
BS24776.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 4..152 | 17..165 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:47 Download gff for
BS24776.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13298872..13299020 | 17..165 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:47 Download gff for
BS24776.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13291972..13292120 | 17..165 | 100 | | Minus |
BS24776.pep Sequence
Translation from 16 to 165
> BS24776.pep
MKSLLFFLLVILCLVGMAPARRKKREVEVWVRPSQNSYNEPCYYQGCQQ*
BS24776.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42481-PB | 49 | CG42481-PB | 1..49 | 1..49 | 264 | 100 | Plus |
CG42481-PA | 49 | CG42481-PA | 1..49 | 1..49 | 264 | 100 | Plus |