Clone BS24776 Report

Search the DGRC for BS24776

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCG42481-RA
Protein status:BS24776.pep: gold
Sequenced Size:182

Clone Sequence Records

BS24776.complete Sequence

182 bp assembled on 2011-06-21

GenBank Submission: KX805110

> BS24776.complete
GAAGTTATCAGTCGACATGAAGTCGCTGCTGTTTTTTCTGTTGGTCATCC
TCTGCCTGGTCGGAATGGCACCAGCCAGGAGAAAGAAAAGGGAGGTCGAG
GTTTGGGTCCGACCAAGTCAAAATTCCTATAACGAGCCATGCTACTATCA
AGGATGCCAACAATGAAAGCTTTCTAGACCAT

BS24776.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42481-RB 150 CG42481-PB 1..150 17..166 750 100 Plus
CG42481-RA 150 CG42481-PA 1..150 17..166 750 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42481-RB 227 CG42481-RB 4..153 17..166 750 100 Plus
CG42481-RA 181 CG42481-RA 4..153 17..166 750 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13298871..13299020 166..17 750 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:12:53 has no hits.

BS24776.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-21 10:23:38 Download gff for BS24776.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 3..151 17..165 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:49:47 Download gff for BS24776.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 4..152 17..165 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:47 Download gff for BS24776.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 4..152 17..165 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:47 Download gff for BS24776.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13298872..13299020 17..165 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:49:47 Download gff for BS24776.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13291972..13292120 17..165 100   Minus

BS24776.pep Sequence

Translation from 16 to 165

> BS24776.pep
MKSLLFFLLVILCLVGMAPARRKKREVEVWVRPSQNSYNEPCYYQGCQQ*

BS24776.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42481-PB 49 CG42481-PB 1..49 1..49 264 100 Plus
CG42481-PA 49 CG42481-PA 1..49 1..49 264 100 Plus