Clone BS24777 Report

Search the DGRC for BS24777

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG12517-RA
Protein status:BS24777.pep: gold
Sequenced Size:449

Clone Sequence Records

BS24777.complete Sequence

449 bp assembled on 2011-06-17

GenBank Submission: KX806439

> BS24777.complete
GAAGTTATCAGTCGACATGAGTAACCTGGGATCAATACTGCTCCTTCTGC
TCATCATCTGTATCGAACGCTCGCGACAGCAACGCTTCTCGCATCCCGAA
TCCTGGACGGATAATGGGATTTACGTTCCCGGTTCGGAGGACGACCTGGA
CTGGACGGGCGCCAATTGGCAGCTGGTGGTCCGCTTTCTGATGCAGCGCC
AGCAGCTGCGTTTCTGCATCGCACTGGCCAGATTCGATGAGCAATTGGTG
CCCGGCACAGCCTGCCAGGCTCTTTTGGCCAACGGCCCGCTTATGGCCAA
CTGCGATATTGGCAACATCGAGGATCTGACCATGACCTTGCGCTATGCCT
TCGGCGAAATTCTGCTGGACACAAGTCGAAAATGCCGTCCTGGCTTGGAG
CTATTCGGAGTTCGCTGCAGGCGGAGGGCATAAAAGCTTTCTAGACCAT

BS24777.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG12517-RA 417 CG12517-PA 1..417 17..433 2085 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG12517-RA 556 CG12517-RA 74..490 17..433 2085 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10870240..10870656 17..433 2085 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:47:41 has no hits.

BS24777.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:34 Download gff for BS24777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 74..488 17..431 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:49 Download gff for BS24777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 74..488 17..431 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:22 Download gff for BS24777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 74..488 17..431 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:22 Download gff for BS24777.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10870240..10870654 17..431 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:49 Download gff for BS24777.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10870240..10870654 17..431 100   Plus

BS24777.pep Sequence

Translation from 16 to 432

> BS24777.pep
MSNLGSILLLLLIICIERSRQQRFSHPESWTDNGIYVPGSEDDLDWTGAN
WQLVVRFLMQRQQLRFCIALARFDEQLVPGTACQALLANGPLMANCDIGN
IEDLTMTLRYAFGEILLDTSRKCRPGLELFGVRCRRRA*

BS24777.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG12517-PA 138 CG12517-PA 1..138 1..138 728 100 Plus