Clone BS24789 Report

Search the DGRC for BS24789

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:247
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG13062-RB
Protein status:BS24789.pep: full length peptide match
Sequenced Size:389

Clone Sequence Records

BS24789.complete Sequence

389 bp assembled on 2011-06-17

GenBank Submission: KX804274

> BS24789.complete
GAAGTTATCAGTCGACATGATGAAACTGGTAGTGTCGCTACTCTCAATTT
GCGCCTTGACGGCAGCTCGTCCTGGTTTCCTGCATGGCCACCACCATCAC
TATCCGGAAATCCCTTACTATCCACACCACCATCATGTGGAACCACTGCA
CTACCATCTGCCCGCCGCCGTCTCCCACCAGAGCTCCACGGTGGTGCACA
GTGTGCCGCACCACATAATCAAGCCGGTCCTGCTGCCCACTGTGGTGAAG
ACAGTGGTGCATCCGCCCATCATCAAGGCTTATCATCCTGCGCCCATCAT
CAAGGCCTACCACCCCTACGATCCCTTCCATCTGCATCACCATCACGACT
TCCACGACTACCATCTGCACTAAAAGCTTTCTAGACCAT

BS24789.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13062-RB 357 CG13062-PB 1..357 17..373 1785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13062-RB 801 CG13062-RB 243..600 17..374 1790 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16314602..16314948 28..374 1735 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:48:32 has no hits.

BS24789.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:38 Download gff for BS24789.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 243..597 17..371 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:43:07 Download gff for BS24789.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 243..597 17..371 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:37 Download gff for BS24789.complete
Subject Subject Range Query Range Percent Splice Strand
CG13062-RB 243..597 17..371 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:37 Download gff for BS24789.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16314602..16314945 28..371 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:43:07 Download gff for BS24789.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16307702..16308045 28..371 100   Plus

BS24789.pep Sequence

Translation from 16 to 372

> BS24789.pep
MMKLVVSLLSICALTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPA
AVSHQSSTVVHSVPHHIIKPVLLPTVVKTVVHPPIIKAYHPAPIIKAYHP
YDPFHLHHHHDFHDYHLH*

BS24789.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24179-PA 122 GF24179-PA 1..108 1..104 427 85.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15983-PA 155 GG15983-PA 40..155 3..118 547 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15874-PA 115 GH15874-PA 1..105 1..104 353 81.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13062-PB 118 CG13062-PB 1..118 1..118 681 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16524-PA 121 GI16524-PA 18..106 18..103 297 84.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17849-PA 126 GL17849-PA 1..109 1..104 329 85.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28512-PA 126 GA28512-PA 1..109 1..104 329 85.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25615-PA 200 GM25615-PA 87..200 5..118 556 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14620-PA 200 GD14620-PA 87..200 5..118 559 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12777-PA 122 GJ12777-PA 18..103 18..98 265 81.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16557-PA 120 GK16557-PA 1..103 1..101 284 80.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23178-PA 160 GE23178-PA 45..146 3..104 435 94.1 Plus
Dyak\GE23098-PA 160 GE23098-PA 45..146 3..104 431 93.1 Plus