Clone BS24814 Report

Search the DGRC for BS24814

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:248
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptCG15423-RA
Protein status:BS24814.pep: full length peptide match
Sequenced Size:356

Clone Sequence Records

BS24814.complete Sequence

356 bp assembled on 2011-06-17

GenBank Submission: KX805256

> BS24814.complete
GAAGTTATCAGTCGACATGCCGTACTACGAGGAGGAACGTCGTCATCACC
ATCATCACCATCACGGTGGAAGGCCAATTGTAGAGGTGGACATTGTGCCG
CCAAGGATTCCTCGACCAGTGATTGAGATCGGAGTGGGCGGCCGGTATCC
ACCACCACCGCCCAGGGTGGAGGTCATCACACCAGCTGCCGTCTACCAGC
CGCCACCACCACGACCCATTATCGAGGTGGATGTGGTGCCACCAAGAGCT
CCCTTCATCGAGTTCAACATCGGCGGTCGGCGTCCACCTCCCAGGGAAGA
GGTCATCATCGTTCAGCAACCCCCACCGCCCAGGTGGTAGAAGCTTTCTA
GACCAT

BS24814.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15423-RA 324 CG15423-PA 1..324 17..340 1605 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15423-RA 566 CG15423-RA 73..396 17..340 1605 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4006113..4006436 17..340 1605 99.7 Plus
Blast to na_te.dros performed on 2014-11-26 14:48:56 has no hits.

BS24814.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-17 17:47:39 Download gff for BS24814.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 73..396 17..340 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:43:15 Download gff for BS24814.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 73..396 17..340 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:44 Download gff for BS24814.complete
Subject Subject Range Query Range Percent Splice Strand
CG15423-RA 73..396 17..340 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:44 Download gff for BS24814.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4006113..4006436 17..340 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:43:15 Download gff for BS24814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4006113..4006436 17..340 99   Plus

BS24814.pep Sequence

Translation from 16 to 339

> BS24814.pep
MPYYEEERRHHHHHHHGGRPIVEVDIVPPRIPRPVIEIGVGGRYPPPPPR
VEVITPAAVYQPPPPRPIIEVDVVPPRAPFIEFNIGGRRPPPREEVIIVQ
QPPPPRW*

BS24814.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15423-PA 107 CG15423-PA 1..107 1..107 608 100 Plus