BS24850.complete Sequence
389 bp assembled on 2011-09-14
GenBank Submission: KX800630
> BS24850.complete
GAAGTTATCAGTCGACATGCAATCCGTGACCAGACAAACGGCGCGAGTCC
TGCCCCAAATGGGCAAACAAGTGAGCTATCTATCGACGAGTGGCGCTTGG
CGGGCAACCGCCAGCGGTGGCGACATGGTGGTCGAGATCAAGGAACCAAA
GACGCGCACCGAGAAGCTAATGGCCTTCCAGAAGAAGCTGCGCGCTAAAA
CGCCGCTGGGCAAGCTGGATGAATTCTCGCGACATCCGTACCAGGAGAAG
GAACCACTCAAGCCCTGGCCCAATCAGACCAATCCGTATACGGGCGAGAT
CGGCGGACCAGCCGGGCCGGAGCCCACACGCTACGGCGACTGGGAGCGCA
AGGGACGCGTCTCCGATTTCTAGAAGCTTTCTAGACCAT
BS24850.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:25:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sirup-RC | 357 | CG7224-PC | 1..357 | 17..373 | 1785 | 100 | Plus |
Sirup-RA | 357 | CG7224-PA | 1..357 | 17..373 | 1785 | 100 | Plus |
CG15283-RB | 381 | CG15283-PB | 240..379 | 232..371 | 340 | 82.9 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:25:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sirup-RC | 727 | CG7224-RC | 245..601 | 17..373 | 1785 | 100 | Plus |
Sirup-RA | 650 | CG7224-RA | 168..524 | 17..373 | 1785 | 100 | Plus |
CG15283-RB | 641 | CG15283-RB | 302..441 | 232..371 | 340 | 82.9 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:25:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7999247..7999550 | 70..373 | 1520 | 100 | Plus |
2L | 23513712 | 2L | 14450482..14450621 | 371..232 | 340 | 82.9 | Minus |
2L | 23513712 | 2L | 7999113..7999167 | 17..71 | 275 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 07:25:04 has no hits.
BS24850.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:29 Download gff for
BS24850.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7224-RA | 180..536 | 17..373 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:36 Download gff for
BS24850.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sirup-RA | 168..524 | 17..373 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:12 Download gff for
BS24850.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sirup-RA | 168..524 | 17..373 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:12 Download gff for
BS24850.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7999249..7999550 | 72..373 | 100 | | Plus |
2L | 7999113..7999167 | 17..71 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:36 Download gff for
BS24850.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7999249..7999550 | 72..373 | 100 | | Plus |
arm_2L | 7999113..7999167 | 17..71 | 100 | -> | Plus |
BS24850.pep Sequence
Translation from 16 to 372
> BS24850.pep
MQSVTRQTARVLPQMGKQVSYLSTSGAWRATASGGDMVVEIKEPKTRTEK
LMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAG
PEPTRYGDWERKGRVSDF*
BS24850.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:16:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sirup-PC | 118 | CG7224-PC | 1..118 | 1..118 | 632 | 100 | Plus |
Sirup-PA | 118 | CG7224-PA | 1..118 | 1..118 | 632 | 100 | Plus |
CG15283-PB | 126 | CG15283-PB | 56..126 | 48..118 | 289 | 70.4 | Plus |