Clone BS24850 Report

Search the DGRC for BS24850

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:248
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptSirup-RA
Protein status:BS24850.pep: full length peptide match
Sequenced Size:389

Clone Sequence Records

BS24850.complete Sequence

389 bp assembled on 2011-09-14

GenBank Submission: KX800630

> BS24850.complete
GAAGTTATCAGTCGACATGCAATCCGTGACCAGACAAACGGCGCGAGTCC
TGCCCCAAATGGGCAAACAAGTGAGCTATCTATCGACGAGTGGCGCTTGG
CGGGCAACCGCCAGCGGTGGCGACATGGTGGTCGAGATCAAGGAACCAAA
GACGCGCACCGAGAAGCTAATGGCCTTCCAGAAGAAGCTGCGCGCTAAAA
CGCCGCTGGGCAAGCTGGATGAATTCTCGCGACATCCGTACCAGGAGAAG
GAACCACTCAAGCCCTGGCCCAATCAGACCAATCCGTATACGGGCGAGAT
CGGCGGACCAGCCGGGCCGGAGCCCACACGCTACGGCGACTGGGAGCGCA
AGGGACGCGTCTCCGATTTCTAGAAGCTTTCTAGACCAT

BS24850.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Sirup-RC 357 CG7224-PC 1..357 17..373 1785 100 Plus
Sirup-RA 357 CG7224-PA 1..357 17..373 1785 100 Plus
CG15283-RB 381 CG15283-PB 240..379 232..371 340 82.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Sirup-RC 727 CG7224-RC 245..601 17..373 1785 100 Plus
Sirup-RA 650 CG7224-RA 168..524 17..373 1785 100 Plus
CG15283-RB 641 CG15283-RB 302..441 232..371 340 82.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7999247..7999550 70..373 1520 100 Plus
2L 23513712 2L 14450482..14450621 371..232 340 82.9 Minus
2L 23513712 2L 7999113..7999167 17..71 275 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:25:04 has no hits.

BS24850.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 12:05:29 Download gff for BS24850.complete
Subject Subject Range Query Range Percent Splice Strand
CG7224-RA 180..536 17..373 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:36 Download gff for BS24850.complete
Subject Subject Range Query Range Percent Splice Strand
Sirup-RA 168..524 17..373 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:12 Download gff for BS24850.complete
Subject Subject Range Query Range Percent Splice Strand
Sirup-RA 168..524 17..373 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:12 Download gff for BS24850.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7999249..7999550 72..373 100   Plus
2L 7999113..7999167 17..71 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:36 Download gff for BS24850.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7999249..7999550 72..373 100   Plus
arm_2L 7999113..7999167 17..71 100 -> Plus

BS24850.pep Sequence

Translation from 16 to 372

> BS24850.pep
MQSVTRQTARVLPQMGKQVSYLSTSGAWRATASGGDMVVEIKEPKTRTEK
LMAFQKKLRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAG
PEPTRYGDWERKGRVSDF*

BS24850.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Sirup-PC 118 CG7224-PC 1..118 1..118 632 100 Plus
Sirup-PA 118 CG7224-PA 1..118 1..118 632 100 Plus
CG15283-PB 126 CG15283-PB 56..126 48..118 289 70.4 Plus