Clone BS24894 Report

Search the DGRC for BS24894

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:248
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG43112-RA
Protein status:BS24894.pep: full length peptide match
Sequenced Size:221

Clone Sequence Records

BS24894.complete Sequence

221 bp assembled on 2012-04-26

GenBank Submission: KX803331

> BS24894.complete
GAAGTTATCAGTCGACATGCGCCCAACACTCCAGGTCCTCATCAGTGTCC
TTTGTCTGGTCTCTGCCTACGCCTGGGATCATACCGACTGTAACGATCAC
TATATCGAATTCATGGACTATCCCGATGAGAGAGCTACCGCCTATAGCAA
TGAATCCTCAGAATGGGATTTCTTTGAATTTTGGAGGCAAGTGTTTGGCC
TGTAGAAGCTTTCTAGACCAT

BS24894.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG43112-RA 189 CG43112-PA 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG43112-RA 340 CG43112-RA 50..243 12..205 955 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11249643..11249836 12..205 955 99.5 Plus
Blast to na_te.dros performed on 2014-11-28 12:28:42 has no hits.

BS24894.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-26 12:21:25 Download gff for BS24894.complete
Subject Subject Range Query Range Percent Splice Strand
CG43112-RA 55..243 17..205 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:43:47 Download gff for BS24894.complete
Subject Subject Range Query Range Percent Splice Strand
CG43112-RA 55..243 17..205 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:05:06 Download gff for BS24894.complete
Subject Subject Range Query Range Percent Splice Strand
CG43112-RA 55..243 17..205 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 13:05:06 Download gff for BS24894.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11249648..11249836 17..205 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:43:47 Download gff for BS24894.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7137153..7137341 17..205 100   Plus

BS24894.pep Sequence

Translation from 16 to 204

> BS24894.pep
MRPTLQVLISVLCLVSAYAWDHTDCNDHYIEFMDYPDERATAYSNESSEW
DFFEFWRQVFGL*

BS24894.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG43112-PA 62 CG43112-PA 1..62 1..62 348 100 Plus