BS24894.complete Sequence
221 bp assembled on 2012-04-26
GenBank Submission: KX803331
> BS24894.complete
GAAGTTATCAGTCGACATGCGCCCAACACTCCAGGTCCTCATCAGTGTCC
TTTGTCTGGTCTCTGCCTACGCCTGGGATCATACCGACTGTAACGATCAC
TATATCGAATTCATGGACTATCCCGATGAGAGAGCTACCGCCTATAGCAA
TGAATCCTCAGAATGGGATTTCTTTGAATTTTGGAGGCAAGTGTTTGGCC
TGTAGAAGCTTTCTAGACCAT
BS24894.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:28:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43112-RA | 189 | CG43112-PA | 1..189 | 17..205 | 945 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:28:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43112-RA | 340 | CG43112-RA | 50..243 | 12..205 | 955 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:28:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11249643..11249836 | 12..205 | 955 | 99.5 | Plus |
Blast to na_te.dros performed on 2014-11-28 12:28:42 has no hits.
BS24894.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-26 12:21:25 Download gff for
BS24894.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43112-RA | 55..243 | 17..205 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:43:47 Download gff for
BS24894.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43112-RA | 55..243 | 17..205 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:05:06 Download gff for
BS24894.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43112-RA | 55..243 | 17..205 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 13:05:06 Download gff for
BS24894.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11249648..11249836 | 17..205 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:43:47 Download gff for
BS24894.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7137153..7137341 | 17..205 | 100 | | Plus |
BS24894.pep Sequence
Translation from 16 to 204
> BS24894.pep
MRPTLQVLISVLCLVSAYAWDHTDCNDHYIEFMDYPDERATAYSNESSEW
DFFEFWRQVFGL*
BS24894.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:24:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43112-PA | 62 | CG43112-PA | 1..62 | 1..62 | 348 | 100 | Plus |