Clone BS24906 Report

Search the DGRC for BS24906

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:249
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG10332-RA
Protein status:BS24906.pep: full length peptide match
Sequenced Size:368

Clone Sequence Records

BS24906.complete Sequence

368 bp assembled on 2011-06-27

GenBank Submission: KX800181

> BS24906.complete
GAAGTTATCAGTCGACATGGACATTAACCCAATAATCAGATCTATTCTCA
GCCGCTTCAGAGGCTGCACCATCAGAAGTTATCTGGTTGTTCTGCCCGAT
CAGAGTCGCATAGAAAATCAACTAAAACTGGAGGATCTGCAAACAGAACG
CGGAATCTTGGATCTGCAATCCCATGAGCTGGCACTCAAGCAAAAGCGCG
TCGAGGCCAATCTAACCGACCTGACCCGCTGCATCCGTGGCATGGAGTTC
GATGTGAAGGTGAATTCCAATCGCGAGAGGAAGGAGAGAAAATCTGATCG
ACGCCCCCCAGCTGATAAGAAATCACCCAAAGTCGGTGATTTCAGCGAAT
AGAAGCTTTCTAGACCAT

BS24906.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG10332-RA 336 CG10332-PA 1..336 17..352 1665 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG10332-RA 739 CG10332-RA 41..377 16..352 1670 99.7 Plus
IM18-RA 739 CG33706-RA 41..377 16..352 1670 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23601276..23601482 352..146 1035 100 Minus
2R 25286936 2R 23601550..23601622 146..74 350 98.6 Minus
2R 25286936 2R 23601674..23601733 75..16 300 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:22:04 has no hits.

BS24906.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:23:58 Download gff for BS24906.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 42..377 17..352 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:05 Download gff for BS24906.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 42..377 17..352 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:39:41 Download gff for BS24906.complete
Subject Subject Range Query Range Percent Splice Strand
IM18-RA 42..377 17..352 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:39:41 Download gff for BS24906.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23601276..23601482 146..352 100 <- Minus
2R 23601551..23601620 76..145 98 <- Minus
2R 23601674..23601732 17..75 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:05 Download gff for BS24906.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19488799..19489005 146..352 100 <- Minus
arm_2R 19489074..19489143 76..145 98 <- Minus
arm_2R 19489197..19489255 17..75 100   Minus

BS24906.pep Sequence

Translation from 16 to 351

> BS24906.pep
MDINPIIRSILSRFRGCTIRSYLVVLPDQSRIENQLKLEDLQTERGILDL
QSHELALKQKRVEANLTDLTRCIRGMEFDVKVNSNRERKERKSDRRPPAD
KKSPKVGDFSE*

BS24906.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG10332-PA 111 CG10332-PA 1..111 1..111 561 100 Plus