Clone BS25056 Report

Search the DGRC for BS25056

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:250
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG33199-RA
Protein status:BS25056.pep: full length peptide match
Sequenced Size:272

Clone Sequence Records

BS25056.complete Sequence

272 bp assembled on 2011-06-27

GenBank Submission: KX803405

> BS25056.complete
GAAGTTATCAGTCGACATGAAAACAAGCAATCTCGGCCTGTACGCTTTCC
GTTTAACCTTCGGTCAGGCGCCGACGTTGTCCACACAGGCCACGACGCAC
TGCAGCCATGGCTTCACCACCAGCTCGTCGTCGCCCAACCGTGTGGTGAC
CCGCTCTGCCACCATGCTGGCGCTCTTCGGCATCGCGCTGTCCTCGTTCA
GCCTTAAGCAACTGCTGGCCAAGAAGCAGAAGCACCAGGGCCTGCGCAAG
CTCTAGAAGCTTTCTAGACCAT

BS25056.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG33199-RB 240 CG33199-PB 1..240 17..256 1200 100 Plus
CG33199-RA 240 CG33199-PA 1..240 17..256 1200 100 Plus
CG8229-RE 882 CG8229-PE 741..882 66..207 710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG33199-RB 1523 CG33199-RB 211..453 16..258 1215 100 Plus
CG33199-RA 1091 CG33199-RA 211..453 16..258 1215 100 Plus
CG8229-RE 1951 CG8229-RE 1121..1313 66..258 965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8948751..8948944 258..65 970 100 Minus
2R 25286936 2R 8950705..8950757 68..16 265 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:54:59 has no hits.

BS25056.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:24:25 Download gff for BS25056.complete
Subject Subject Range Query Range Percent Splice Strand
CG33199-RA 230..469 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:06:06 Download gff for BS25056.complete
Subject Subject Range Query Range Percent Splice Strand
CG33199-RA 212..451 17..256 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:51:42 Download gff for BS25056.complete
Subject Subject Range Query Range Percent Splice Strand
CG33199-RA 212..451 17..256 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:51:42 Download gff for BS25056.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8948753..8948941 68..256 100 <- Minus
2R 8950706..8950756 17..67 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:06:06 Download gff for BS25056.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4836258..4836446 68..256 100 <- Minus
arm_2R 4838211..4838261 17..67 100   Minus

BS25056.pep Sequence

Translation from 16 to 255

> BS25056.pep
MKTSNLGLYAFRLTFGQAPTLSTQATTHCSHGFTTSSSSPNRVVTRSATM
LALFGIALSSFSLKQLLAKKQKHQGLRKL*

BS25056.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG33199-PB 79 CG33199-PB 1..79 1..79 393 100 Plus
CG33199-PA 79 CG33199-PA 1..79 1..79 393 100 Plus