BS25067.complete Sequence
248 bp assembled on 2011-06-27
GenBank Submission: KX800255
> BS25067.complete
GAAGTTATCAGTCGACATGAAGCTGATCGCATTGTGCTGCCTGCTCCTTT
TGGGCCTCCTGGGCTTCCTAGCTGCTCCCGGCGTCGCCTCGCCATCTCGC
CACACTGGACCAGGAAACGGATCGGGATCTGGAGCTGGGTCCGGAAATCC
GTTCAGGTCTCCAAGCTCACAGCAACGACCACTGTACTACGACGCTCCGA
TTGGGAAACCATCGAAGACTATGTACGCCTGAAAGCTTTCTAGACCAT
BS25067.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:55:37
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| IM18-RB | 216 | CG33706-PB | 1..216 | 17..232 | 1080 | 100 | Plus |
| IM18-RA | 216 | CG33706-PA | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:55:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG10332-RA | 739 | CG10332-RA | 483..699 | 16..232 | 1085 | 100 | Plus |
| IM18-RB | 286 | CG33706-RB | 30..246 | 16..232 | 1085 | 100 | Plus |
| IM18-RA | 739 | CG33706-RA | 483..699 | 16..232 | 1085 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:55:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 23600954..23601170 | 232..16 | 1085 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:55:36 has no hits.
BS25067.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:24:27 Download gff for
BS25067.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG10332-RA | 484..698 | 17..231 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:06:16 Download gff for
BS25067.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG10332-RA | 484..698 | 17..231 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:51:57 Download gff for
BS25067.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| IM18-RA | 484..698 | 17..231 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:51:57 Download gff for
BS25067.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 23600955..23601169 | 17..231 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:06:16 Download gff for
BS25067.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 19488478..19488692 | 17..231 | 100 | | Minus |
BS25067.pep Sequence
Translation from 16 to 231
> BS25067.pep
MKLIALCCLLLLGLLGFLAAPGVASPSRHTGPGNGSGSGAGSGNPFRSPS
SQQRPLYYDAPIGKPSKTMYA*
BS25067.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:46:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dere\GG20014-PA | 71 | GG20014-PA | 19..71 | 19..71 | 212 | 79.2 | Plus |
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:46:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| IM18-PB | 71 | CG33706-PB | 1..71 | 1..71 | 375 | 100 | Plus |
| IM18-PA | 71 | CG33706-PA | 1..71 | 1..71 | 375 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:46:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsec\GM15526-PA | 69 | GM15526-PA | 21..69 | 21..71 | 191 | 80.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:46:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dsim\GD25031-PA | 69 | GD25031-PA | 21..69 | 21..71 | 191 | 80.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:46:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dyak\GE11551-PA | 66 | GE11551-PA | 1..66 | 1..71 | 129 | 77.5 | Plus |
