Clone BS25075 Report

Search the DGRC for BS25075

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:250
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG33218-RA
Protein status:BS25075.pep: full length peptide match
Sequenced Size:296

Clone Sequence Records

BS25075.complete Sequence

296 bp assembled on 2011-06-28

GenBank Submission: KX804192

> BS25075.complete
GAAGTTATCAGTCGACATGGCTAAAATAAATCTTTGGTTGGGTAAACTCC
GTGACTCTGTTCTGTCCAGGCTGCAGAGCATCAAGAAACCCCTACCCCTT
CCTTCGACCAAGGGCCCCCTCAATGCCAATGAAACCTCAAATTCCGAAGG
TAATATTAGTGACTTTCAGCAGGGCGATCCAATAATTCCACCCATCGAAG
CTAACAAAATGATACCGAGGCCTCAAAATGGATTCGTCAGCCGAGCCCTC
TACTACCGAGGATACTACATTAGGCGTTAAAAGCTTTCTAGACCAT

BS25075.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 15:59:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-26 15:59:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2330411..2330617 75..281 1035 100 Plus
X 23542271 X 2330296..2330355 17..76 300 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:59:40 has no hits.

BS25075.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-28 12:03:50 Download gff for BS25075.complete
Subject Subject Range Query Range Percent Splice Strand
CG33218-RA 138..399 17..278 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:45 Download gff for BS25075.complete
Subject Subject Range Query Range Percent Splice Strand
X 2330296..2330355 17..76 100 -> Plus
X 2330413..2330614 77..278 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:08:45 Download gff for BS25075.complete
Subject Subject Range Query Range Percent Splice Strand
X 2330296..2330355 17..76 100 -> Plus
X 2330413..2330614 77..278 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:49:37 Download gff for BS25075.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2224329..2224388 17..76 100 -> Plus
arm_X 2224446..2224647 77..278 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:49:37 Download gff for BS25075.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2224329..2224388 17..76 100 -> Plus
arm_X 2224446..2224647 77..278 100   Plus

BS25075.pep Sequence

Translation from 16 to 279

> BS25075.pep
MAKINLWLGKLRDSVLSRLQSIKKPLPLPSTKGPLNANETSNSEGNISDF
QQGDPIIPPIEANKMIPRPQNGFVSRALYYRGYYIRR*
Sequence BS25075.pep has no blast hits.