Clone BS25136 Report

Search the DGRC for BS25136

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:251
Well:36
Vector:pDNR-Dual
Associated Gene/TranscriptCG5532-RA
Protein status:BS25136.pep: full length peptide match
Sequenced Size:371

Clone Sequence Records

BS25136.complete Sequence

371 bp assembled on 2011-06-27

GenBank Submission: KX803440

> BS25136.complete
GAAGTTATCAGTCGACATGCCGGTGGATTGGTTCGGATATGTGTACGCAG
CCACGGTCGCCGCCGGAGGAATCATGGGATACGCCAAGGCGGGTTCCATT
CCCTCGCTGGGTGCTGGTCTGGCCTTCGGAGCCCTGCTCGGTTATGGCGC
CCACCTCAACTCCCAGGACACGCCTCGTCCCCTGCTCCAGCTGGGCACCT
CCCTGTTCCTGGCCGGGCTGATGGGCGCCCGCTGGAACCGATCCGGAAAA
CTGATGCCCGCCGGAATGGTGTGCATGCTATCCGTGGCCGCCTTGGTCAA
GAACCTGGCCACCTATAATCGCTACCTAATGCCTGCCGGCACAAAGGCCC
CTTAGAAGCTTTCTAGACCAT

BS25136.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG5532-RB 339 CG5532-PB 1..339 17..355 1650 99.1 Plus
CG5532-RA 339 CG5532-PA 1..339 17..355 1650 99.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG5532-RB 703 CG5532-RB 72..415 12..355 1660 98.8 Plus
CG5532-RA 594 CG5532-RA 72..415 12..355 1660 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23752964..23753227 92..355 1275 98.9 Plus
2R 25286936 2R 23752825..23752907 12..94 400 98.8 Plus
Blast to na_te.dros performed on 2014-11-26 15:42:54 has no hits.

BS25136.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:24:39 Download gff for BS25136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 90..428 17..355 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:42:40 Download gff for BS25136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 77..415 17..355 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:05 Download gff for BS25136.complete
Subject Subject Range Query Range Percent Splice Strand
CG5532-RA 77..415 17..355 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:05 Download gff for BS25136.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23752830..23752905 17..92 100 -> Plus
2R 23752965..23753227 93..355 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:42:40 Download gff for BS25136.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19640353..19640428 17..92 100 -> Plus
arm_2R 19640488..19640750 93..355 98   Plus

BS25136.pep Sequence

Translation from 16 to 354

> BS25136.pep
MPVDWFGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQ
DTPRPLLQLGTSLFLAGLMGARWNRSGKLMPAGMVCMLSVAALVKNLATY
NRYLMPAGTKAP*

BS25136.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG5532-PB 112 CG5532-PB 1..112 1..112 582 100 Plus
CG5532-PA 112 CG5532-PA 1..112 1..112 582 100 Plus