BS25204.complete Sequence
425 bp assembled on 2011-06-27
GenBank Submission: KX805881
> BS25204.complete
GAAGTTATCAGTCGACATGGAAAGGAAACCAAGTATACCAAAAATCAGGC
AGGTCAGCAGTCTTGGAAGTCAATTCACTTTTCCCAATATAGCGGATCTA
TTTTGCAATGCCGTCTCCATTCACAATGACTATTGTAAATTGCATTTTAT
AAACGAAAAGTTGCAATTCCATTTAAATGGAATGTTGGAAAGTAAAGATG
CTTCAGCGATTTACTATTTTAAGCAACATATTATTCTAAACTCGGATCAA
CTGGAATCTGCATCCAAAAATTATGACATGACCTTTCATACAATAATGAG
CGACGTTGACCGATTTCGGTACCGACAATGTAACGACATCTTGGCCCCTG
GAACAAATTTTTCCGTTTTAAAGTCAAAATATAATATCATTAGAAATGAC
ATTCATTAAAAGCTTTCTAGACCAT
BS25204.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:57:41
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG17490-RF | 393 | CG17490-PF | 1..393 | 17..409 | 1965 | 100 | Plus |
| CG17490-RG | 2124 | CG17490-PG | 1732..2124 | 17..409 | 1965 | 100 | Plus |
| CG17490-RE | 2124 | CG17490-PE | 1732..2124 | 17..409 | 1965 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:57:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG17490-RF | 2953 | CG17490-RF | 1756..2148 | 17..409 | 1965 | 100 | Plus |
| CG17490-RG | 2877 | CG17490-RG | 2376..2768 | 17..409 | 1965 | 100 | Plus |
| CG17490-RE | 2315 | CG17490-RE | 1814..2206 | 17..409 | 1965 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:57:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 22540043..22540324 | 17..298 | 1410 | 100 | Plus |
| 2L | 23513712 | 2L | 22540377..22540488 | 298..409 | 560 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 15:57:40
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dkoe\Gandalf | 979 | Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). | 42..82 | 179..138 | 108 | 76.2 | Minus |
BS25204.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-27 10:25:22 Download gff for
BS25204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG17490-RE | 1754..2144 | 17..407 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:48:45 Download gff for
BS25204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG17490-RA | 430..820 | 17..407 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:53 Download gff for
BS25204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG17490-RE | 1814..2204 | 17..407 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:07:53 Download gff for
BS25204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 22540043..22540324 | 17..298 | 100 | -> | Plus |
| 2L | 22540378..22540486 | 299..407 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:48:45 Download gff for
BS25204.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 22432775..22433056 | 17..298 | 100 | -> | Plus |
| arm_2L | 22433110..22433218 | 299..407 | 100 | | Plus |
BS25204.pep Sequence
Translation from 16 to 408
> BS25204.pep
MERKPSIPKIRQVSSLGSQFTFPNIADLFCNAVSIHNDYCKLHFINEKLQ
FHLNGMLESKDASAIYYFKQHIILNSDQLESASKNYDMTFHTIMSDVDRF
RYRQCNDILAPGTNFSVLKSKYNIIRNDIH*
BS25204.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:47:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG17490-PF | 130 | CG17490-PF | 1..130 | 1..130 | 686 | 100 | Plus |
| CG17490-PA | 130 | CG17490-PA | 1..130 | 1..130 | 686 | 100 | Plus |
| CG17490-PG | 707 | CG17490-PG | 578..707 | 1..130 | 686 | 100 | Plus |
| CG17490-PE | 707 | CG17490-PE | 578..707 | 1..130 | 686 | 100 | Plus |
| CG17490-PD | 103 | CG17490-PD | 1..94 | 1..94 | 494 | 100 | Plus |
