Clone BS25309 Report

Search the DGRC for BS25309

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:253
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG31788-RA
Protein status:BS25309.pep: full length peptide match
Sequenced Size:212

Clone Sequence Records

BS25309.complete Sequence

212 bp assembled on 2011-07-25

GenBank Submission: KX801573

> BS25309.complete
GAAGTTATCAGTCGACATGTTTGAGTCTTTCGATTGGACCTTGGGATTAG
ATTTGAAGAACTTTCGCGATGTGAAACAGCGTGTAGTAAGAAAAATCGGG
GAACTGGAGCAACATGGAGCCAAGTGGGGTCGCCTCATCGGCATCGAAGA
TGGCAAGGATGATGCTTTCATTCGTTTCATGAAGCAGAACATTTAGAAGC
TTTCTAGACCAT

BS25309.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31788-RB 180 CG31788-PB 1..180 17..196 900 100 Plus
CG31788-RA 180 CG31788-PA 1..180 17..196 900 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG31788-RB 425 CG31788-RB 141..320 17..196 900 100 Plus
CG31788-RA 349 CG31788-RA 65..244 17..196 900 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18257599..18257773 196..22 875 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:18:47 has no hits.

BS25309.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-25 15:09:01 Download gff for BS25309.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 71..244 23..196 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:53:58 Download gff for BS25309.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 71..244 23..196 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:57:19 Download gff for BS25309.complete
Subject Subject Range Query Range Percent Splice Strand
CG31788-RA 71..244 23..196 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:57:19 Download gff for BS25309.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18257599..18257772 23..196 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:53:58 Download gff for BS25309.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18257599..18257772 23..196 100   Minus

BS25309.pep Sequence

Translation from 16 to 195

> BS25309.pep
MFESFDWTLGLDLKNFRDVKQRVVRKIGELEQHGAKWGRLIGIEDGKDDA
FIRFMKQNI*

BS25309.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG31788-PB 59 CG31788-PB 1..59 1..59 313 100 Plus
CG31788-PA 59 CG31788-PA 1..59 1..59 313 100 Plus