Clone BS25312 Report

Search the DGRC for BS25312

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:253
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptAcp95EF-RA
Protein status:BS25312.pep: gold
Sequenced Size:191

Clone Sequence Records

BS25312.complete Sequence

191 bp assembled on 2011-07-25

GenBank Submission: KX806281

> BS25312.complete
GAAGTTATCAGTCGACATGGCCTCAGTAAAATTGTTCTTTATTGCTATTT
TGGTTGTAGCTCTATCCCTTAACACCTCAGCTGCAGTGTTGAACCCTAGT
TCGACTGCCAAACCCAGATTTGAGACGAAAGACCGAAAACTAAGTGCTGG
CGCTCTGCAGTCACTCGCTGGTTAAAAGCTTTCTAGACCAT

BS25312.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Acp95EF-RA 159 CG17924-PA 1..159 17..175 795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Acp95EF-RA 243 CG17924-RA 16..176 15..175 805 100 Plus
Spase22-23-RB 1694 CG5677-RB 824..965 175..34 710 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24229071..24229212 34..175 710 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:18:40 has no hits.

BS25312.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-25 15:03:16 Download gff for BS25312.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 18..174 17..173 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:53:54 Download gff for BS25312.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 18..174 17..173 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:57:16 Download gff for BS25312.complete
Subject Subject Range Query Range Percent Splice Strand
Acp95EF-RA 18..174 17..173 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:57:16 Download gff for BS25312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24229072..24229210 35..173 100   Plus
3R 24228992..24229009 17..34 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:53:54 Download gff for BS25312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20054794..20054932 35..173 100   Plus
arm_3R 20054714..20054731 17..34 100 -> Plus

BS25312.pep Sequence

Translation from 16 to 174

> BS25312.pep
MASVKLFFIAILVVALSLNTSAAVLNPSSTAKPRFETKDRKLSAGALQSL
AG*

BS25312.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Acp95EF-PA 52 CG17924-PA 1..52 1..52 242 100 Plus