BS25312.complete Sequence
191 bp assembled on 2011-07-25
GenBank Submission: KX806281
> BS25312.complete
GAAGTTATCAGTCGACATGGCCTCAGTAAAATTGTTCTTTATTGCTATTT
TGGTTGTAGCTCTATCCCTTAACACCTCAGCTGCAGTGTTGAACCCTAGT
TCGACTGCCAAACCCAGATTTGAGACGAAAGACCGAAAACTAAGTGCTGG
CGCTCTGCAGTCACTCGCTGGTTAAAAGCTTTCTAGACCAT
BS25312.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:18:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp95EF-RA | 159 | CG17924-PA | 1..159 | 17..175 | 795 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:18:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp95EF-RA | 243 | CG17924-RA | 16..176 | 15..175 | 805 | 100 | Plus |
Spase22-23-RB | 1694 | CG5677-RB | 824..965 | 175..34 | 710 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:18:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 24229071..24229212 | 34..175 | 710 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 22:18:40 has no hits.
BS25312.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-25 15:03:16 Download gff for
BS25312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 18..174 | 17..173 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:53:54 Download gff for
BS25312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 18..174 | 17..173 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:57:16 Download gff for
BS25312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp95EF-RA | 18..174 | 17..173 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:57:16 Download gff for
BS25312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 24229072..24229210 | 35..173 | 100 | | Plus |
3R | 24228992..24229009 | 17..34 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:53:54 Download gff for
BS25312.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 20054794..20054932 | 35..173 | 100 | | Plus |
arm_3R | 20054714..20054731 | 17..34 | 100 | -> | Plus |
BS25312.pep Sequence
Translation from 16 to 174
> BS25312.pep
MASVKLFFIAILVVALSLNTSAAVLNPSSTAKPRFETKDRKLSAGALQSL
AG*
BS25312.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:06:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp95EF-PA | 52 | CG17924-PA | 1..52 | 1..52 | 242 | 100 | Plus |