Clone BS25315 Report

Search the DGRC for BS25315

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:253
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG34296-RA
Protein status:BS25315.pep: full length peptide match
Sequenced Size:308

Clone Sequence Records

BS25315.complete Sequence

308 bp assembled on 2011-07-25

GenBank Submission: KX802129

> BS25315.complete
GAAGTTATCAGTCGACATGAAGCTGGCCCTGCTCCTGATCCTCTGCTGTT
GCCTCATCGGAATGGCGATTGGTGACTCGGTTTTGGTGACCAAGCCGCCG
TTCATTCGCAGTCGCTATAGCTTGCGTTGGAGGAAGACAACCACTGTGGC
GCCTGAAGTGGTCACTGGATCCAGTGGATCAACCGTTAACACGGTCACCA
CCACCGACCATCCCAAGCTGGCCACTTCCACCGCCAGTTCGGATTACGAC
TATTACGGAAATGGGGAGACGGAGAATGTGGTGCACAAGTAAAAGCTTTC
TAGACCAT

BS25315.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34296-RA 276 CG34296-PA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34296-RA 420 CG34296-RA 22..297 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29722663..29722890 65..292 1140 100 Plus
3R 32079331 3R 29722559..29722607 17..65 245 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:09:20 has no hits.

BS25315.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-25 14:58:06 Download gff for BS25315.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 18..291 17..290 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:48:37 Download gff for BS25315.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 22..295 17..290 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:52:50 Download gff for BS25315.complete
Subject Subject Range Query Range Percent Splice Strand
CG34296-RA 22..295 17..290 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:52:50 Download gff for BS25315.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29722559..29722607 17..65 100 -> Plus
3R 29722664..29722888 66..290 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:48:37 Download gff for BS25315.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25548281..25548329 17..65 100 -> Plus
arm_3R 25548386..25548610 66..290 100   Plus

BS25315.pep Sequence

Translation from 16 to 291

> BS25315.pep
MKLALLLILCCCLIGMAIGDSVLVTKPPFIRSRYSLRWRKTTTVAPEVVT
GSSGSTVNTVTTTDHPKLATSTASSDYDYYGNGETENVVHK*

BS25315.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34296-PA 91 CG34296-PA 1..91 1..91 473 100 Plus