BS25388.complete Sequence
164 bp assembled on 2011-08-23
GenBank Submission: KX805593
> BS25388.complete
GAAGTTATCAGTCGACATGGTTTGCAAAGGCTGCGGAACAAACTGCAAGT
GCCAGGACACCAAGTGCGGCGACAATTGCGCCTGTAATCAGGACTGCAAG
TGCGTGTGCAAGAATGGCCCCAAAGATCAGTGTTGCAAGAGCAAGTAGAA
GCTTTCTAGACCAT
BS25388.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:00:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MtnC-RA | 132 | CG5097-PA | 1..132 | 17..148 | 660 | 100 | Plus |
MtnB-RC | 132 | CG4312-PC | 1..121 | 17..137 | 275 | 81.8 | Plus |
MtnB-RB | 132 | CG4312-PB | 1..121 | 17..137 | 275 | 81.8 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:00:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MtnC-RA | 268 | CG5097-RA | 39..170 | 17..148 | 660 | 100 | Plus |
MtnB-RC | 456 | CG4312-RC | 89..209 | 17..137 | 275 | 81.8 | Plus |
MtnB-RB | 448 | CG4312-RB | 217..337 | 17..137 | 275 | 81.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:00:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 20360430..20360536 | 42..148 | 535 | 100 | Plus |
3R | 32079331 | 3R | 20503349..20503424 | 137..62 | 200 | 84.2 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:00:36 has no hits.
BS25388.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 17:56:43 Download gff for
BS25388.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
MtnC-RA | 39..170 | 17..148 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:02:13 Download gff for
BS25388.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
MtnC-RA | 39..170 | 17..148 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:00:40 Download gff for
BS25388.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
MtnC-RA | 39..170 | 17..148 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:00:40 Download gff for
BS25388.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 20360346..20360370 | 17..41 | 100 | -> | Plus |
3R | 20360430..20360536 | 42..148 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:02:13 Download gff for
BS25388.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 16186068..16186092 | 17..41 | 100 | -> | Plus |
arm_3R | 16186152..16186258 | 42..148 | 100 | | Plus |
BS25388.pep Sequence
Translation from 16 to 147
> BS25388.pep
MVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQCCKSK*
BS25388.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
MtnC-PA | 43 | CG5097-PA | 1..43 | 1..43 | 273 | 100 | Plus |
MtnB-PC | 43 | CG4312-PC | 1..43 | 1..43 | 234 | 81.4 | Plus |
MtnB-PB | 43 | CG4312-PB | 1..43 | 1..43 | 234 | 81.4 | Plus |
MtnB-PA | 43 | CG4312-PA | 1..43 | 1..43 | 234 | 81.4 | Plus |
MtnD-PB | 44 | CG33192-PB | 1..43 | 1..43 | 210 | 72.1 | Plus |