Clone BS25388 Report

Search the DGRC for BS25388

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:253
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptMtnC-RA
Protein status:BS25388.pep: gold
Sequenced Size:164

Clone Sequence Records

BS25388.complete Sequence

164 bp assembled on 2011-08-23

GenBank Submission: KX805593

> BS25388.complete
GAAGTTATCAGTCGACATGGTTTGCAAAGGCTGCGGAACAAACTGCAAGT
GCCAGGACACCAAGTGCGGCGACAATTGCGCCTGTAATCAGGACTGCAAG
TGCGTGTGCAAGAATGGCCCCAAAGATCAGTGTTGCAAGAGCAAGTAGAA
GCTTTCTAGACCAT

BS25388.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
MtnC-RA 132 CG5097-PA 1..132 17..148 660 100 Plus
MtnB-RC 132 CG4312-PC 1..121 17..137 275 81.8 Plus
MtnB-RB 132 CG4312-PB 1..121 17..137 275 81.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
MtnC-RA 268 CG5097-RA 39..170 17..148 660 100 Plus
MtnB-RC 456 CG4312-RC 89..209 17..137 275 81.8 Plus
MtnB-RB 448 CG4312-RB 217..337 17..137 275 81.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20360430..20360536 42..148 535 100 Plus
3R 32079331 3R 20503349..20503424 137..62 200 84.2 Minus
Blast to na_te.dros performed on 2014-11-27 07:00:36 has no hits.

BS25388.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-23 17:56:43 Download gff for BS25388.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 39..170 17..148 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:02:13 Download gff for BS25388.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 39..170 17..148 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:00:40 Download gff for BS25388.complete
Subject Subject Range Query Range Percent Splice Strand
MtnC-RA 39..170 17..148 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:00:40 Download gff for BS25388.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20360346..20360370 17..41 100 -> Plus
3R 20360430..20360536 42..148 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:02:13 Download gff for BS25388.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16186068..16186092 17..41 100 -> Plus
arm_3R 16186152..16186258 42..148 100   Plus

BS25388.pep Sequence

Translation from 16 to 147

> BS25388.pep
MVCKGCGTNCKCQDTKCGDNCACNQDCKCVCKNGPKDQCCKSK*

BS25388.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
MtnC-PA 43 CG5097-PA 1..43 1..43 273 100 Plus
MtnB-PC 43 CG4312-PC 1..43 1..43 234 81.4 Plus
MtnB-PB 43 CG4312-PB 1..43 1..43 234 81.4 Plus
MtnB-PA 43 CG4312-PA 1..43 1..43 234 81.4 Plus
MtnD-PB 44 CG33192-PB 1..43 1..43 210 72.1 Plus