Clone BS25702 Report

Search the DGRC for BS25702

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:257
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptRpL38-RA
Protein status:BS25702.pep: full length peptide match
Sequenced Size:245

Clone Sequence Records

BS25702.complete Sequence

245 bp assembled on 2011-08-02

GenBank Submission: KX805374

> BS25702.complete
GAAGTTATCAGTCGACATGCCACGGGAAATTAAAGAAGTTAAAGATTTTC
TTAATAAGGCACGCCGTTCTGATGCGCGTGCTGTAAAAATCAAGAAAAAT
CCCACTAACACCAAATTTAAGATCCGTTGTTCGAGGTTCCTTTACACCCT
TGTCGTACAGGATAAAGAAAAGGCTGACAAAATTAAGCAGTCTTTACCGC
CTGGACTACAAGTAAAGGAGGTGAAATAAAAGCTTTCTAGACCAT

BS25702.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
RpL38-RA 213 CG18001-PA 1..213 17..229 1065 100 Plus
RpL38-RB 213 CG18001-PB 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
RpL38-RA 401 CG18001-RA 82..295 17..230 1070 100 Plus
RpL38-RB 1013 CG18001-RB 82..295 17..230 1070 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4516106..4516319 230..17 1070 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:30:06 has no hits.

BS25702.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-02 12:42:36 Download gff for BS25702.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RA 80..290 17..227 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:00:12 Download gff for BS25702.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RB 82..292 17..227 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:02:54 Download gff for BS25702.complete
Subject Subject Range Query Range Percent Splice Strand
RpL38-RB 82..292 17..227 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:02:54 Download gff for BS25702.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4516109..4516319 17..227 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:00:12 Download gff for BS25702.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 403614..403824 17..227 100   Minus

BS25702.pep Sequence

Translation from 16 to 228

> BS25702.pep
MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDK
EKADKIKQSLPPGLQVKEVK*

BS25702.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
RpL38-PA 70 CG18001-PA 1..70 1..70 353 100 Plus
RpL38-PB 70 CG18001-PB 1..70 1..70 353 100 Plus