BS25702.complete Sequence
245 bp assembled on 2011-08-02
GenBank Submission: KX805374
> BS25702.complete
GAAGTTATCAGTCGACATGCCACGGGAAATTAAAGAAGTTAAAGATTTTC
TTAATAAGGCACGCCGTTCTGATGCGCGTGCTGTAAAAATCAAGAAAAAT
CCCACTAACACCAAATTTAAGATCCGTTGTTCGAGGTTCCTTTACACCCT
TGTCGTACAGGATAAAGAAAAGGCTGACAAAATTAAGCAGTCTTTACCGC
CTGGACTACAAGTAAAGGAGGTGAAATAAAAGCTTTCTAGACCAT
BS25702.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:30:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL38-RA | 213 | CG18001-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
RpL38-RB | 213 | CG18001-PB | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:30:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL38-RA | 401 | CG18001-RA | 82..295 | 17..230 | 1070 | 100 | Plus |
RpL38-RB | 1013 | CG18001-RB | 82..295 | 17..230 | 1070 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:30:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 4516106..4516319 | 230..17 | 1070 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 22:30:06 has no hits.
BS25702.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-02 12:42:36 Download gff for
BS25702.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RA | 80..290 | 17..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:00:12 Download gff for
BS25702.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RB | 82..292 | 17..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:02:54 Download gff for
BS25702.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL38-RB | 82..292 | 17..227 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:02:54 Download gff for
BS25702.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4516109..4516319 | 17..227 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:00:12 Download gff for
BS25702.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 403614..403824 | 17..227 | 100 | | Minus |
BS25702.pep Sequence
Translation from 16 to 228
> BS25702.pep
MPREIKEVKDFLNKARRSDARAVKIKKNPTNTKFKIRCSRFLYTLVVQDK
EKADKIKQSLPPGLQVKEVK*
BS25702.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:09:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL38-PA | 70 | CG18001-PA | 1..70 | 1..70 | 353 | 100 | Plus |
RpL38-PB | 70 | CG18001-PB | 1..70 | 1..70 | 353 | 100 | Plus |