Clone BS25703 Report

Search the DGRC for BS25703

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:257
Well:3
Vector:pDNR-Dual
Associated Gene/TranscriptSmD1-RA
Protein status:BS25703.pep: full length peptide match
Sequenced Size:407

Clone Sequence Records

BS25703.complete Sequence

407 bp assembled on 2011-08-02

GenBank Submission: KX801291

> BS25703.complete
GAAGTTATCAGTCGACATGAAATTAGTAAGATTCCTTATGAAGCTAAGTC
ACGAGACCGTGACCATCGAACTGAAGAACGGCACCCAGATCCACGGCACC
ATTACCGGCGTGGATGTGGCCATGAACACTCACCTGAAGAGCGTTCGGAT
GACGATCAAGAACCGGGATCCCGTCCACCTGGAGACGCTGAGCATTCGCG
GCAACAACATCAGATACTTTATACTGCCGGACAGCCTGCCGCTGGAGACG
CTCCTCATCGACGACACCCCGAAGTCGAAGACAAAAAAGAAGGACAGCGG
CCGCGTGGGAAATCGCGGCAGGGGCAGAGGCGCCCGCGGACGAGGTGGTC
CACGGGGTCGCGGAAGGGGCCGAGCTTCAGGCCGACGTTAAAAGCTTTCT
AGACCAT

BS25703.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
SmD1-RA 375 CG10753-PA 1..375 17..391 1875 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
SmD1-RA 729 CG10753-RA 94..470 15..391 1885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12733623..12733985 391..29 1815 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:30:13 has no hits.

BS25703.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-02 12:42:37 Download gff for BS25703.complete
Subject Subject Range Query Range Percent Splice Strand
SmD1-RA 93..465 17..389 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:00:15 Download gff for BS25703.complete
Subject Subject Range Query Range Percent Splice Strand
SmD1-RA 96..468 17..389 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:02:57 Download gff for BS25703.complete
Subject Subject Range Query Range Percent Splice Strand
SmD1-RA 96..468 17..389 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:02:57 Download gff for BS25703.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12733625..12733983 31..389 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:00:15 Download gff for BS25703.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12726725..12727083 31..389 100 <- Minus

BS25703.pep Sequence

Translation from 16 to 390

> BS25703.pep
MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNR
DPVHLETLSIRGNNIRYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNR
GRGRGARGRGGPRGRGRGRASGRR*

BS25703.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25112-PA 124 GF25112-PA 1..124 1..124 624 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13810-PA 124 GG13810-PA 1..124 1..124 619 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14721-PA 124 GH14721-PA 1..94 1..94 440 95.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
SmD1-PA 124 CG10753-PA 1..124 1..124 637 100 Plus
SmD3-PA 151 CG8427-PA 7..121 8..118 139 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12268-PA 124 GI12268-PA 1..93 1..93 434 95.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24936-PA 118 GL24936-PA 1..87 8..94 444 98.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10544-PA 125 GA10544-PA 1..94 1..94 480 98.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24635-PA 124 GM24635-PA 1..124 1..124 624 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12704-PA 124 GD12704-PA 1..124 1..124 624 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11498-PA 80 GJ11498-PA 1..49 45..93 213 95.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18761-PA 124 GK18761-PA 1..94 1..94 471 95.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20102-PA 124 GE20102-PA 1..124 1..124 624 100 Plus