Clone BS25707 Report

Search the DGRC for BS25707

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:257
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptGadd45-RA
Protein status:BS25707.pep: full length peptide match
Sequenced Size:524

Clone Sequence Records

BS25707.complete Sequence

524 bp assembled on 2011-08-02

GenBank Submission: KX804667

> BS25707.complete
GAAGTTATCAGTCGACATGGTCGTCGAGGAGAACTGCAGCATGCACCACC
TGGAGCGCGAACTGGACCTGGAGCTAGAGATCGATATGGCCATGGAGTGT
GCCCCCATCGGACGCACCATCAAGTCGGCCCTTCTAAGGGCCCAGAGCGA
GGCGCGTGTGATCGTGGGCCTGTCCGCCGCCATCAACGTGCTCTCCAAGT
CGCCGGAGGGATCCCTCTTCTGCCTGATGGCCCAGCCCAAGGACGGCGAC
TCTGCCACCCACATGCACGAGGTACTGCTGGAGGCCTTTTGCTACGAGAA
CGACATCTACGTGATCAAGGTGGACGACGCCACCAAGCTGAGCCGCATCC
TCGGCCAGGACTCCGTCGAGTCGTGCTGCCTGGTCCAGAAGGTCTGGGCC
GACGCCCCCGAGGAGCAGCTGACCAAGGCCGAGAACCAGCTAGTCGACTA
CTGCGAGGCCCACTGGGACGCCCCCCAGCAGCCCATTGTCCAGCTGCCGG
CTGTGTAGAAGCTTTCTAGACCAT

BS25707.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Gadd45-RA 492 CG11086-PA 1..492 17..508 2460 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
Gadd45-RA 1495 CG11086-RA 261..752 17..508 2460 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7249421..7249912 17..508 2460 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:31:15 has no hits.

BS25707.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-02 12:42:39 Download gff for BS25707.complete
Subject Subject Range Query Range Percent Splice Strand
Gadd45-RA 259..750 17..508 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:00:46 Download gff for BS25707.complete
Subject Subject Range Query Range Percent Splice Strand
Gadd45-RA 261..752 17..508 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:03:22 Download gff for BS25707.complete
Subject Subject Range Query Range Percent Splice Strand
Gadd45-RA 261..752 17..508 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:03:22 Download gff for BS25707.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7249421..7249912 17..508 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:00:46 Download gff for BS25707.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3136926..3137417 17..508 100   Plus

BS25707.pep Sequence

Translation from 16 to 507

> BS25707.pep
MVVEENCSMHHLERELDLELEIDMAMECAPIGRTIKSALLRAQSEARVIV
GLSAAINVLSKSPEGSLFCLMAQPKDGDSATHMHEVLLEAFCYENDIYVI
KVDDATKLSRILGQDSVESCCLVQKVWADAPEEQLTKAENQLVDYCEAHW
DAPQQPIVQLPAV*

BS25707.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12703-PA 169 GF12703-PA 1..169 1..163 737 84 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23269-PA 163 GG23269-PA 1..163 1..163 825 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21525-PA 168 GH21525-PA 1..168 1..163 670 78.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Gadd45-PA 163 CG11086-PA 1..163 1..163 843 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19497-PA 162 GI19497-PA 1..162 1..163 684 81.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:47:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11158-PA 160 GL11158-PA 1..160 1..163 721 84.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10750-PA 160 GA10750-PA 1..160 1..163 729 85.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20942-PA 163 GM20942-PA 1..163 1..163 845 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15338-PA 93 GD15338-PA 1..93 71..163 495 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21062-PA 160 GJ21062-PA 1..160 1..163 673 80.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21796-PA 154 GK21796-PA 1..154 1..163 664 79.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19117-PA 163 GE19117-PA 1..163 1..163 847 98.2 Plus