Clone BS25804 Report

Search the DGRC for BS25804

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:258
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptVha14-1-RA
Protein status:BS25804.pep: full length peptide match
Sequenced Size:407

Clone Sequence Records

BS25804.complete Sequence

407 bp assembled on 2011-08-02

GenBank Submission: KX801689

> BS25804.complete
GAAGTTATCAGTCGACATGGCTCTGCACTCGGCAATCAAGGGAAAACTGA
TCAGCGTTATCGGCGACGAGGACACCTGTGTGGGCTTTCTGCTCGGCGGA
GTGGGCGAGATCAACAAGAATCGCCATCCCAACTTTATGGTGGTCGACAA
AAATACGGCCGTCAGCGAACTGGAGGACTGTTTCAAGCGTTTCCTTAAGC
GGGACGATATCGACATCATTCTAATCAACCAGAACTGCGCCGAGCTTATT
CGTCATGTGATCGATGCCCATACGTCGCCCGTGCCCGCTGTTTTGGAGAT
TCCCTCCAAGGACCATCCGTACGACGCCAGCAAGGACTCCATTCTGCGTC
GCGCCCGCGGCATGTTCAATCCGGAGGATCTGGTGCGCTAAAAGCTTTCT
AGACCAT

BS25804.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
Vha14-1-RA 375 CG8210-PA 1..375 17..391 1875 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
Vha14-1-RA 659 CG8210-RA 98..477 12..391 1885 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:52:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15679608..15679987 391..12 1885 99.7 Minus
Blast to na_te.dros performed on 2014-11-27 00:52:54 has no hits.

BS25804.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-02 14:31:30 Download gff for BS25804.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 99..471 17..389 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:37:14 Download gff for BS25804.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 103..475 17..389 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:12:20 Download gff for BS25804.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 103..475 17..389 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:12:20 Download gff for BS25804.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15679610..15679982 17..389 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:37:14 Download gff for BS25804.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11567115..11567487 17..389 100   Minus

BS25804.pep Sequence

Translation from 16 to 390

> BS25804.pep
MALHSAIKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVS
ELEDCFKRFLKRDDIDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDH
PYDASKDSILRRARGMFNPEDLVR*

BS25804.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Vha14-1-PA 124 CG8210-PA 1..124 1..124 644 100 Plus
Vha14-2-PC 124 CG1076-PC 1..121 1..121 387 57.9 Plus
Vha14-2-PB 124 CG1076-PB 1..121 1..121 387 57.9 Plus
Vha14-2-PA 129 CG1076-PA 51..126 46..121 231 56.6 Plus