Clone BS25902 Report

Search the DGRC for BS25902

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:259
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG34439-RA
Protein status:BS25902.pep: full length peptide match
Sequenced Size:254

Clone Sequence Records

BS25902.complete Sequence

254 bp assembled on 2011-08-02

GenBank Submission: KX802137

> BS25902.complete
GAAGTTATCAGTCGACATGTGGTTCGAAATCCTACCTGGTGCGGTGATCA
TCACCACGCTCCTCTCGGTGCCCATATACGCCATGTACGGCCTGGACAAG
CTGATGATCGGCAATGCTTTCCGGCGCAACATGGACGAGCGTTTCAGCCG
AGTTATGTACCAGCGCGATTTCCGACTGACCGACAATCCCTACAAGATGA
ACGGTCTGGATGCCATACCGGATGAGAAAACGAACTAAAAGCTTTCTAGA
CCAT

BS25902.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG34439-RA 222 CG34439-PA 1..222 17..238 1110 100 Plus
CG34439-RB 372 CG34439-PB 1..191 17..207 955 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG34439-RA 384 CG34439-RA 83..304 17..238 1110 100 Plus
CG34439-RB 728 CG34439-RB 83..273 17..207 955 100 Plus
TppII-RD 4641 CG3991-RD 38..125 203..116 440 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13158748..13158847 17..116 500 100 Plus
2R 25286936 2R 13159017..13159104 116..203 440 100 Plus
2R 25286936 2R 13159534..13159569 203..238 180 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:21:06 has no hits.

BS25902.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-02 12:42:20 Download gff for BS25902.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 136..355 17..236 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:55:06 Download gff for BS25902.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 83..302 17..236 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:58:24 Download gff for BS25902.complete
Subject Subject Range Query Range Percent Splice Strand
CG34439-RA 83..302 17..236 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:58:24 Download gff for BS25902.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13159017..13159103 116..202 100 -> Plus
2R 13159534..13159567 203..236 100   Plus
2R 13158748..13158846 17..115 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:55:06 Download gff for BS25902.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9046522..9046608 116..202 100 -> Plus
arm_2R 9047039..9047072 203..236 100   Plus
arm_2R 9046253..9046351 17..115 100 -> Plus

BS25902.pep Sequence

Translation from 16 to 237

> BS25902.pep
MWFEILPGAVIITTLLSVPIYAMYGLDKLMIGNAFRRNMDERFSRVMYQR
DFRLTDNPYKMNGLDAIPDEKTN*

BS25902.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34439-PA 73 CG34439-PA 1..73 1..73 384 100 Plus
CG34439-PB 123 CG34439-PB 1..71 1..71 360 95.8 Plus