BS25902.complete Sequence
254 bp assembled on 2011-08-02
GenBank Submission: KX802137
> BS25902.complete
GAAGTTATCAGTCGACATGTGGTTCGAAATCCTACCTGGTGCGGTGATCA
TCACCACGCTCCTCTCGGTGCCCATATACGCCATGTACGGCCTGGACAAG
CTGATGATCGGCAATGCTTTCCGGCGCAACATGGACGAGCGTTTCAGCCG
AGTTATGTACCAGCGCGATTTCCGACTGACCGACAATCCCTACAAGATGA
ACGGTCTGGATGCCATACCGGATGAGAAAACGAACTAAAAGCTTTCTAGA
CCAT
BS25902.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34439-RA | 222 | CG34439-PA | 1..222 | 17..238 | 1110 | 100 | Plus |
CG34439-RB | 372 | CG34439-PB | 1..191 | 17..207 | 955 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34439-RA | 384 | CG34439-RA | 83..304 | 17..238 | 1110 | 100 | Plus |
CG34439-RB | 728 | CG34439-RB | 83..273 | 17..207 | 955 | 100 | Plus |
TppII-RD | 4641 | CG3991-RD | 38..125 | 203..116 | 440 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:21:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 13158748..13158847 | 17..116 | 500 | 100 | Plus |
2R | 25286936 | 2R | 13159017..13159104 | 116..203 | 440 | 100 | Plus |
2R | 25286936 | 2R | 13159534..13159569 | 203..238 | 180 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 22:21:06 has no hits.
BS25902.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-02 12:42:20 Download gff for
BS25902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 136..355 | 17..236 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:55:06 Download gff for
BS25902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 83..302 | 17..236 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:58:24 Download gff for
BS25902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34439-RA | 83..302 | 17..236 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:58:24 Download gff for
BS25902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13159017..13159103 | 116..202 | 100 | -> | Plus |
2R | 13159534..13159567 | 203..236 | 100 | | Plus |
2R | 13158748..13158846 | 17..115 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:55:06 Download gff for
BS25902.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 9046522..9046608 | 116..202 | 100 | -> | Plus |
arm_2R | 9047039..9047072 | 203..236 | 100 | | Plus |
arm_2R | 9046253..9046351 | 17..115 | 100 | -> | Plus |
BS25902.pep Sequence
Translation from 16 to 237
> BS25902.pep
MWFEILPGAVIITTLLSVPIYAMYGLDKLMIGNAFRRNMDERFSRVMYQR
DFRLTDNPYKMNGLDAIPDEKTN*
BS25902.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:07:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34439-PA | 73 | CG34439-PA | 1..73 | 1..73 | 384 | 100 | Plus |
CG34439-PB | 123 | CG34439-PB | 1..71 | 1..71 | 360 | 95.8 | Plus |