Clone BS25904 Report

Search the DGRC for BS25904

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:259
Well:4
Vector:pDNR-Dual
Associated Gene/Transcriptpen-2-RA
Protein status:BS25904.pep: full length peptide match
Sequenced Size:338

Clone Sequence Records

BS25904.complete Sequence

338 bp assembled on 2011-08-02

GenBank Submission: KX804719

> BS25904.complete
GAAGTTATCAGTCGACATGGACATCTCAAAGGCACCAAATCCGCGAAAAC
TGGAGCTGTGTCGCAAATACTTCTTTGCTGGCTTTGCATTTCTGCCCTTT
GTGTGGGCCATTAACGTTTGCTGGTTTTTCACGGAGGCCTTCCATAAGCC
ACCATTTTCGGAGCAGAGCCAAATAAAGAGATATGTTATATACTCTGCAG
TGGGGACTCTATTCTGGCTGATAGTACTAACTGCCTGGATAATAATATTC
CAGACAAATCGCACAGCCTGGGGCGCCACAGCGGACTATATGAGCTTCAT
CATACCCCTAGGCAGTGCATAGAAGCTTTCTAGACCAT

BS25904.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
pen-2-RB 306 CG33198-PB 1..306 17..322 1530 100 Plus
pen-2-RA 306 CG33198-PA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
pen-2-RB 1181 CG33198-RB 182..489 16..323 1540 100 Plus
pen-2-RA 543 CG33198-RA 182..489 16..323 1540 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18277930..18278070 183..323 705 100 Plus
2R 25286936 2R 18277746..18277855 73..182 535 99.1 Plus
2R 25286936 2R 18277620..18277681 16..77 310 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:21:24 has no hits.

BS25904.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-02 12:42:21 Download gff for BS25904.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 96..401 17..322 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:55:15 Download gff for BS25904.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 183..488 17..322 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:58:33 Download gff for BS25904.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 183..488 17..322 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:58:33 Download gff for BS25904.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18277930..18278069 183..322 100   Plus
2R 18277751..18277855 78..182 100 -> Plus
2R 18277621..18277681 17..77 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:55:15 Download gff for BS25904.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14165256..14165360 78..182 100 -> Plus
arm_2R 14165435..14165574 183..322 100   Plus
arm_2R 14165126..14165186 17..77 100 -> Plus

BS25904.pep Sequence

Translation from 16 to 321

> BS25904.pep
MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQ
SQIKRYVIYSAVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGS
A*

BS25904.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
pen-2-PB 101 CG33198-PB 1..101 1..101 548 100 Plus
pen-2-PA 101 CG33198-PA 1..101 1..101 548 100 Plus