BS25904.complete Sequence
338 bp assembled on 2011-08-02
GenBank Submission: KX804719
> BS25904.complete
GAAGTTATCAGTCGACATGGACATCTCAAAGGCACCAAATCCGCGAAAAC
TGGAGCTGTGTCGCAAATACTTCTTTGCTGGCTTTGCATTTCTGCCCTTT
GTGTGGGCCATTAACGTTTGCTGGTTTTTCACGGAGGCCTTCCATAAGCC
ACCATTTTCGGAGCAGAGCCAAATAAAGAGATATGTTATATACTCTGCAG
TGGGGACTCTATTCTGGCTGATAGTACTAACTGCCTGGATAATAATATTC
CAGACAAATCGCACAGCCTGGGGCGCCACAGCGGACTATATGAGCTTCAT
CATACCCCTAGGCAGTGCATAGAAGCTTTCTAGACCAT
BS25904.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pen-2-RB | 306 | CG33198-PB | 1..306 | 17..322 | 1530 | 100 | Plus |
pen-2-RA | 306 | CG33198-PA | 1..306 | 17..322 | 1530 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pen-2-RB | 1181 | CG33198-RB | 182..489 | 16..323 | 1540 | 100 | Plus |
pen-2-RA | 543 | CG33198-RA | 182..489 | 16..323 | 1540 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:21:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18277930..18278070 | 183..323 | 705 | 100 | Plus |
2R | 25286936 | 2R | 18277746..18277855 | 73..182 | 535 | 99.1 | Plus |
2R | 25286936 | 2R | 18277620..18277681 | 16..77 | 310 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 22:21:24 has no hits.
BS25904.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-02 12:42:21 Download gff for
BS25904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pen-2-RA | 96..401 | 17..322 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:55:15 Download gff for
BS25904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pen-2-RA | 183..488 | 17..322 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:58:33 Download gff for
BS25904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pen-2-RA | 183..488 | 17..322 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:58:33 Download gff for
BS25904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18277930..18278069 | 183..322 | 100 | | Plus |
2R | 18277751..18277855 | 78..182 | 100 | -> | Plus |
2R | 18277621..18277681 | 17..77 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:55:15 Download gff for
BS25904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14165256..14165360 | 78..182 | 100 | -> | Plus |
arm_2R | 14165435..14165574 | 183..322 | 100 | | Plus |
arm_2R | 14165126..14165186 | 17..77 | 100 | -> | Plus |
BS25904.pep Sequence
Translation from 16 to 321
> BS25904.pep
MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQ
SQIKRYVIYSAVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGS
A*
BS25904.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:07:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pen-2-PB | 101 | CG33198-PB | 1..101 | 1..101 | 548 | 100 | Plus |
pen-2-PA | 101 | CG33198-PA | 1..101 | 1..101 | 548 | 100 | Plus |