Clone BS26001 Report

Search the DGRC for BS26001

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:260
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptGXIVsPLA2-RC
Protein status:BS26001.pep: full length peptide match
Sequenced Size:131

Clone Sequence Records

BS26001.complete Sequence

131 bp assembled on 2011-08-09

GenBank Submission: KX804190

> BS26001.complete
GAAGTTATCAGTCGACATGCAGTTCTCTTGGATGAAGGTGGCCATATACC
TTCTTACGTTCCTAACCTACGCCTATTCAGGCTATGGATCCAGCACCATA
GTCCACGTAAGCTAAAAGCTTTCTAGACCAT

BS26001.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
GXIVsPLA2-RC 99 CG17035-PC 1..99 17..115 495 100 Plus
GXIVsPLA2-RD 693 CG17035-PD 1..95 17..111 460 98.9 Plus
GXIVsPLA2-RA 693 CG17035-PA 1..95 17..111 460 98.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:45:18
Subject Length Description Subject Range Query Range Score Percent Strand
GXIVsPLA2-RC 1021 CG17035-RC 123..223 15..115 505 100 Plus
GXIVsPLA2-RD 1229 CG17035-RD 123..219 15..111 470 99 Plus
GXIVsPLA2-RA 1016 CG17035-RA 123..219 15..111 470 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15955218..15955314 15..111 485 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:45:15 has no hits.

BS26001.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-09 11:11:31 Download gff for BS26001.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RC 46..142 17..113 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:07 Download gff for BS26001.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RC 125..221 17..113 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:31:12 Download gff for BS26001.complete
Subject Subject Range Query Range Percent Splice Strand
GXIVsPLA2-RC 125..221 17..113 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:31:12 Download gff for BS26001.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15955220..15955316 17..113 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:07 Download gff for BS26001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15948320..15948416 17..113 98   Plus

BS26001.pep Sequence

Translation from 16 to 114

> BS26001.pep
MQFSWMKVAIYLLTFLTYAYSGYGSSTIVHVS*

BS26001.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24097-PA 226 GF24097-PA 1..31 1..31 165 96.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15933-PA 230 GG15933-PA 1..31 1..31 167 96.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14770-PA 230 GH14770-PA 1..31 1..31 160 93.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
GXIVsPLA2-PC 32 CG17035-PC 1..32 1..32 166 100 Plus
GXIVsPLA2-PD 230 CG17035-PD 1..31 1..31 159 96.8 Plus
GXIVsPLA2-PA 230 CG17035-PA 1..31 1..31 159 96.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11872-PA 228 GI11872-PA 1..31 1..31 161 93.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25215-PA 228 GL25215-PA 1..31 1..31 161 96.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14287-PA 228 GA14287-PA 1..31 1..31 161 96.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25562-PA 230 GM25562-PA 1..31 1..31 167 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14577-PA 230 GD14577-PA 1..31 1..31 167 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13568-PA 228 GJ13568-PA 1..31 1..31 164 93.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16013-PA 232 GK16013-PA 1..31 1..31 160 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22866-PA 230 GE22866-PA 1..31 1..31 167 96.8 Plus
Dyak\GE22283-PA 315 GE22283-PA 1..30 1..30 166 100 Plus