BS26007.complete Sequence
482 bp assembled on 2012-04-25
GenBank Submission: KX801633
> BS26007.complete
GAAGTTATCAGTCGACATGTGGAGGAAAGCGAGCAGGTTGGTCAGGGAAA
CCACCTCGTGGAAAACGCGTCGTCAGGGACAAGCGGAAGCCCCATCAGCA
GCAGTAGCAACAATAAAACCATCGACAAGGACGAGCACGCCGATTGCCCA
CGGATTACCCATCATCATCACATGGTCGCAGCTCGCTATTGTTGCTGCTG
TTGCAGTGCTCCTGCAATGCCACGTCTGTCAAGCAGCCGGACGAGCTCCA
CCGGAACCCTACTACGGTCGCTATATTGGAGATTTTACCAACTTTGCCCA
TGGCATTAAGGGTCAAATCTACGCGGTGGACGAGTCGACGCTGTTCGTCA
AATCCTTTGCCTACGACGGCACCGGACCGGACGCCTTCTTCTGGGTGGGC
AAGACGCCAAGGCCCAGTCCCGATGGCTACATCATTCCCTATCCGGAGGA
GTACACGGGCATGTGAAAGCTTTCTAGACCAT
BS26007.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:01:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34355-RF | 2247 | CG34355-PF | 1..447 | 17..463 | 2235 | 100 | Plus |
| CG34355-RB | 2247 | CG34355-PB | 1..447 | 17..463 | 2235 | 100 | Plus |
| CG34355-RE | 2268 | CG34355-PE | 1..447 | 17..463 | 2235 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:01:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34355-RF | 6414 | CG34355-RF | 1118..1564 | 17..463 | 2235 | 100 | Plus |
| CG34355-RB | 6235 | CG34355-RB | 939..1385 | 17..463 | 2235 | 100 | Plus |
| CG34355-RE | 6256 | CG34355-RE | 939..1385 | 17..463 | 2235 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:01:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 23821530..23821746 | 17..233 | 1085 | 100 | Plus |
| 3R | 32079331 | 3R | 23830176..23830333 | 309..466 | 790 | 100 | Plus |
| 3R | 32079331 | 3R | 23829955..23830034 | 232..311 | 400 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 12:01:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2496..2530 | 93..127 | 112 | 80 | Plus |
| Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2440..2493 | 82..138 | 107 | 68.4 | Plus |
BS26007.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-25 15:17:11 Download gff for
BS26007.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34355-RC | 917..1365 | 17..465 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:37:28 Download gff for
BS26007.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34355-RC | 939..1387 | 17..465 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:55:42 Download gff for
BS26007.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34355-RE | 939..1386 | 17..465 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:55:42 Download gff for
BS26007.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 23821530..23821746 | 17..233 | 100 | -> | Plus |
| 3R | 23829957..23830033 | 234..310 | 100 | -> | Plus |
| 3R | 23830178..23830332 | 311..465 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:37:28 Download gff for
BS26007.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 19647252..19647468 | 17..233 | 100 | -> | Plus |
| arm_3R | 19655679..19655755 | 234..310 | 100 | -> | Plus |
| arm_3R | 19655900..19656054 | 311..465 | 100 | | Plus |
BS26007.pep Sequence
Translation from 16 to 465
> BS26007.pep
MWRKASRLVRETTSWKTRRQGQAEAPSAAVATIKPSTRTSTPIAHGLPII
ITWSQLAIVAAVAVLLQCHVCQAAGRAPPEPYYGRYIGDFTNFAHGIKGQ
IYAVDESTLFVKSFAYDGTGPDAFFWVGKTPRPSPDGYIIPYPEEYTGM*
BS26007.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:22:48
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34355-PF | 748 | CG34355-PF | 1..149 | 1..149 | 799 | 100 | Plus |
| CG34355-PB | 748 | CG34355-PB | 1..149 | 1..149 | 799 | 100 | Plus |
| CG34355-PE | 755 | CG34355-PE | 1..149 | 1..149 | 799 | 100 | Plus |
| knk-PA | 689 | CG6217-PA | 17..103 | 58..146 | 194 | 37.1 | Plus |
| Skeletor-PB | 289 | CG14681-PA | 15..87 | 65..137 | 183 | 47.9 | Plus |
