Clone BS26101 Report

Search the DGRC for BS26101

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:261
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG6770-RA
Protein status:BS26101.pep: full length peptide match
Sequenced Size:242

Clone Sequence Records

BS26101.complete Sequence

242 bp assembled on 2011-08-24

GenBank Submission: KX804798

> BS26101.complete
GAAGTTATCAGTCGACATGTCCGAGGCCCACTTCGATGAGTACGAGCACT
ACAACTTCGACCATGACAAGCACATCTTCTCTGGACACAGCGGCAAGCAG
CGCAACAAGAGGGAGGCCAATGAGCACACCAACCACTTCGATCCCTCCGG
TCATTCCCGCAAGATTCTGACCAAGCTGATGAACACCAACAACAACAACA
AGAAAGCCGCCGCATGCAAGAACTGAAAGCTTTCTAGACCAT

BS26101.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6770-RA 210 CG6770-PA 1..210 17..226 1035 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG6770-RA 776 CG6770-RA 144..353 17..226 1035 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12045766..12045975 226..17 1035 99.5 Minus
Blast to na_te.dros performed on 2014-11-26 16:37:05 has no hits.

BS26101.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:39:35 Download gff for BS26101.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 126..334 17..225 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:05:22 Download gff for BS26101.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 144..352 17..225 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:23:18 Download gff for BS26101.complete
Subject Subject Range Query Range Percent Splice Strand
CG6770-RA 144..352 17..225 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:23:18 Download gff for BS26101.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12045767..12045975 17..225 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:05:22 Download gff for BS26101.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12045767..12045975 17..225 99   Minus

BS26101.pep Sequence

Translation from 16 to 225

> BS26101.pep
MSEAHFDEYEHYNFDHDKHIFSGHSGKQRNKREANEHTNHFDPSGHSRKI
LTKLMNTNNNNKKAAACKN*

BS26101.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6770-PA 69 CG6770-PA 1..69 1..69 386 100 Plus