BS26106.complete Sequence
230 bp assembled on 2012-04-25
GenBank Submission: KX806296
> BS26106.complete
GAAGTTATCAGTCGACATGTCGCAGATCGGAGAACTGGGCAGTGGAGCCG
GCAACGGCGGCGGCGGCGGCGGATCCATCCGGGAGGCGGGCGGTTCATTT
GGCAAAATGGAGGCTGCTCGCGAGGAGGAGTTCTTCTACAAGCAGCAAAA
GGAGCAACTGAAGAACCTGAAGACCAAGACGGAGCCTAAGGCACCAGAGG
CTCCCAAGAAGTGAAAGCTTTCTAGACCAT
BS26106.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 11:59:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34423-RB | 258 | CG34423-PB | 61..258 | 17..214 | 990 | 100 | Plus |
| CG34423-RA | 198 | CG34423-PA | 1..198 | 17..214 | 990 | 100 | Plus |
| CG13551-RB | 324 | CG13551-PB | 88..210 | 38..160 | 315 | 83.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 11:59:36
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34423-RB | 468 | CG34423-RB | 167..364 | 17..214 | 990 | 100 | Plus |
| CG34423-RA | 406 | CG34423-RA | 105..302 | 17..214 | 990 | 100 | Plus |
| CG13551-RB | 637 | CG13551-RB | 218..340 | 38..160 | 315 | 83.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 11:59:33
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 23358843..23358971 | 17..145 | 645 | 100 | Plus |
| 2R | 25286936 | 2R | 23359028..23359100 | 142..214 | 365 | 100 | Plus |
| 2R | 25286936 | 2R | 23382618..23382722 | 142..38 | 270 | 83.8 | Minus |
Blast to na_te.dros performed on 2014-11-28 11:59:34 has no hits.
BS26106.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-25 15:17:02 Download gff for
BS26106.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34423-RB | 61..257 | 17..213 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:36:43 Download gff for
BS26106.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34423-RA | 105..301 | 17..213 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:55:05 Download gff for
BS26106.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34423-RA | 105..301 | 17..213 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 12:55:05 Download gff for
BS26106.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 23358843..23358971 | 17..145 | 100 | -> | Plus |
| 2R | 23359032..23359099 | 146..213 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:36:43 Download gff for
BS26106.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 19246366..19246494 | 17..145 | 100 | -> | Plus |
| arm_2R | 19246555..19246622 | 146..213 | 100 | | Plus |
BS26106.pep Sequence
Translation from 16 to 213
> BS26106.pep
MSQIGELGSGAGNGGGGGGSIREAGGSFGKMEAAREEEFFYKQQKEQLKN
LKTKTEPKAPEAPKK*
BS26106.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:22:50
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34423-PA | 65 | CG34423-PA | 1..65 | 1..65 | 336 | 100 | Plus |
| CG34423-PB | 85 | CG34423-PB | 21..85 | 1..65 | 336 | 100 | Plus |
| CG13551-PB | 107 | CG13551-PB | 24..74 | 2..52 | 224 | 80.4 | Plus |
| CG13551-PA | 107 | CG13551-PA | 24..74 | 2..52 | 224 | 80.4 | Plus |
