BS26111.complete Sequence
290 bp assembled on 2011-08-24
GenBank Submission: KX805670
> BS26111.complete
GAAGTTATCAGTCGACATGGCTTTTAGGAACTGGTTTTCGCTTCCCGCCG
TCAGAGCTGATGACGAAGAGGACTTAGTTGACCCTCAAGCAGTTTTAAGG
GAAAAATGTCAAGCTAAAGGTCACATAGAATCCTTGTACAATAAGTACCA
AGAGTGCAATGATCGTGTTAATGGGCGATCCAAAACAACTGAGACTTGCA
TCGAAGAATTATTTGACTATGTTGCTGAGTTAGATCATTGCGTTTCGCAC
AGTCTTTTTACAAAGCTTAAGTAAAAGCTTTCTAGACCAT
BS26111.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:36:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ucrh-RD | 258 | CG41623-PD | 1..258 | 17..274 | 1290 | 100 | Plus |
| Ucrh-RC | 258 | CG41623-PC | 1..258 | 17..274 | 1290 | 100 | Plus |
| Ucrh-RB | 258 | CG41623-PB | 1..258 | 17..274 | 1290 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:36:21
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ucrh-RD | 506 | CG41623-RD | 95..353 | 17..275 | 1295 | 100 | Plus |
| Ucrh-RC | 434 | CG41623-RC | 97..355 | 17..275 | 1295 | 100 | Plus |
| Ucrh-RB | 416 | CG41623-RB | 79..337 | 17..275 | 1295 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:36:17
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 25121043..25121218 | 100..275 | 880 | 100 | Plus |
| 3L | 28110227 | 3L | 25120902..25120991 | 17..106 | 435 | 98.9 | Plus |
| 2R | 25286936 | 2R | 8677379..8677576 | 58..255 | 435 | 81.3 | Plus |
Blast to na_te.dros performed on 2014-11-26 16:36:18 has no hits.
BS26111.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:39:34 Download gff for
BS26111.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ucrh-RD | 102..357 | 17..272 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:05:03 Download gff for
BS26111.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ucrh-RB | 79..334 | 17..272 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:23:02 Download gff for
BS26111.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ucrh-RB | 79..334 | 17..272 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:23:02 Download gff for
BS26111.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 25121044..25121215 | 101..272 | 100 | | Plus |
| 3L | 25120902..25120985 | 17..100 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:05:03 Download gff for
BS26111.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3LHet | 606358..606441 | 17..100 | 100 | -> | Plus |
| 3LHet | 606500..606671 | 101..272 | 100 | | Plus |
BS26111.pep Sequence
Translation from 16 to 273
> BS26111.pep
MAFRNWFSLPAVRADDEEDLVDPQAVLREKCQAKGHIESLYNKYQECNDR
VNGRSKTTETCIEELFDYVAELDHCVSHSLFTKLK*
BS26111.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:24:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ucrh-PD | 85 | CG41623-PD | 1..85 | 1..85 | 456 | 100 | Plus |
| Ucrh-PC | 85 | CG41623-PC | 1..85 | 1..85 | 456 | 100 | Plus |
| Ucrh-PB | 85 | CG41623-PB | 1..85 | 1..85 | 456 | 100 | Plus |
| CG30354-PB | 86 | CG30354-PB | 1..86 | 1..85 | 360 | 77.9 | Plus |
| CG30354-PA | 86 | CG30354-PA | 1..86 | 1..85 | 360 | 77.9 | Plus |
