Clone BS26112 Report

Search the DGRC for BS26112

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:261
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG15203-RA
Protein status:BS26112.pep: gold
Sequenced Size:419

Clone Sequence Records

BS26112.complete Sequence

419 bp assembled on 2011-08-24

GenBank Submission: KX804185

> BS26112.complete
GAAGTTATCAGTCGACATGCATCCGGAACGCTACGCCAGTCCAAATCCAT
TGATACCATTGGTAATCGCAGGCGCCCTGCTCTTCTCGATGCTCTCGCAG
GTGAGCGGCTACTCGGGACGAATTCCACCGGATGCAGATAATCCCGGGAA
GTGCATGTACCGCGGTGACGTCCTGGAACTGGGTGTCAACAATGGCATCG
CTCCCTGCCAGCGACTGACTTGCAACAAGGATGGATCAATACTTATCGAG
GGTTGCGGCAAACTGCGCATCGAAAACTGCAACCGAGGCGAGCGAATCTC
TCCGGGTGAACCCTTTCCGGAATGCTGCAAGCTGAGATACAAGTGCAAGC
AAATCGGAGCGGCACCCTACTACATCGAGCGGAATACGGCGGAGAAGGTC
TAGAAGCTTTCTAGACCAT

BS26112.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15203-RB 387 CG15203-PB 1..387 17..403 1935 100 Plus
CG15203-RA 387 CG15203-PA 1..387 17..403 1935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15203-RB 900 CG15203-RB 61..447 17..403 1935 100 Plus
CG15203-RA 610 CG15203-RA 53..439 17..403 1935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11067775..11067926 252..403 760 100 Plus
X 23542271 X 11066612..11066732 17..137 605 100 Plus
X 23542271 X 11066813..11066930 135..252 590 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:36:38 has no hits.

BS26112.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:39:34 Download gff for BS26112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15203-RA 33..419 17..403 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:05:11 Download gff for BS26112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15203-RA 53..439 17..403 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:23:08 Download gff for BS26112.complete
Subject Subject Range Query Range Percent Splice Strand
CG15203-RA 53..439 17..403 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:23:08 Download gff for BS26112.complete
Subject Subject Range Query Range Percent Splice Strand
X 11066612..11066732 17..137 100 -> Plus
X 11066816..11066930 138..252 100 -> Plus
X 11067776..11067926 253..403 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:05:11 Download gff for BS26112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10960645..10960765 17..137 100 -> Plus
arm_X 10960849..10960963 138..252 100 -> Plus
arm_X 10961809..10961959 253..403 100   Plus

BS26112.pep Sequence

Translation from 16 to 402

> BS26112.pep
MHPERYASPNPLIPLVIAGALLFSMLSQVSGYSGRIPPDADNPGKCMYRG
DVLELGVNNGIAPCQRLTCNKDGSILIEGCGKLRIENCNRGERISPGEPF
PECCKLRYKCKQIGAAPYYIERNTAEKV*

BS26112.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG15203-PB 128 CG15203-PB 1..128 1..128 697 100 Plus
CG15203-PA 128 CG15203-PA 1..128 1..128 697 100 Plus