Clone BS26114 Report

Search the DGRC for BS26114

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:261
Well:14
Vector:pDNR-Dual
Associated Gene/Transcripthoip-RA
Protein status:BS26114.pep: full length peptide match
Sequenced Size:416

Clone Sequence Records

BS26114.complete Sequence

416 bp assembled on 2011-08-24

GenBank Submission: KX803361

> BS26114.complete
GAAGTTATCAGTCGACATGACTGAGGAAGTTAATCCCAAGGCATTCCCGC
TGGCCGATGCCCAGCTTACCGCCAAGATCATGAACTTGCTGCAGCAAGCA
TTGAACTACAATCAACTGCGCAAGGGAGCCAACGAGGCCACCAAGACCCT
CAATCGCGGACTGGCCGATATTGTGGTGCTGGCCGGTGATGCGGAGCCCA
TCGAGATTCTGCTCCATTTGCCGCTCCTGTGCGAGGACAAGAACGTGCCC
TACGTCTTCGTTCGTTCCAAGCAGGCCTTGGGGCGTGCGTGCGGAGTTTC
CCGGCCAATAGTCGCCTGCTCTGTGACCACCAACGAGGGCAGCCAGCTCA
AGTCGCAGATCACCTCCATTCAGCAGGAGATCGAGCGACTGCTAGTCTAG
AAGCTTTCTAGACCAT

BS26114.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
hoip-RB 384 CG3949-PB 1..384 17..400 1920 100 Plus
hoip-RA 384 CG3949-PA 1..384 17..400 1920 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
hoip-RB 607 CG3949-RB 145..528 17..400 1920 100 Plus
hoip-RA 569 CG3949-RA 107..490 17..400 1920 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9699999..9700380 19..400 1910 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:39:07 has no hits.

BS26114.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:39:38 Download gff for BS26114.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 145..528 17..400 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:06:13 Download gff for BS26114.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 107..490 17..400 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:24:08 Download gff for BS26114.complete
Subject Subject Range Query Range Percent Splice Strand
hoip-RA 107..490 17..400 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:24:08 Download gff for BS26114.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9699998..9700380 17..400 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:06:13 Download gff for BS26114.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9699998..9700380 17..400 99   Plus

BS26114.pep Sequence

Translation from 16 to 399

> BS26114.pep
MTEEVNPKAFPLADAQLTAKIMNLLQQALNYNQLRKGANEATKTLNRGLA
DIVVLAGDAEPIEILLHLPLLCEDKNVPYVFVRSKQALGRACGVSRPIVA
CSVTTNEGSQLKSQITSIQQEIERLLV*

BS26114.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
hoip-PB 127 CG3949-PB 1..127 1..127 631 100 Plus
hoip-PA 127 CG3949-PA 1..127 1..127 631 100 Plus
NHP2-PB 160 CG5258-PB 37..156 5..125 194 35.2 Plus
NHP2-PA 160 CG5258-PA 37..156 5..125 194 35.2 Plus