Clone BS26142 Report

Search the DGRC for BS26142

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:261
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptRbp1-RA
Protein status:BS26142.pep: gold
Sequenced Size:440

Clone Sequence Records

BS26142.complete Sequence

440 bp assembled on 2011-08-24

GenBank Submission: KX800682

> BS26142.complete
GAAGTTATCAGTCGACATGCCGCGATATAGGGAGTGGGACTTGGCCTGCA
AGGTGTACGTGGGAAACCTGGGCTCCTCGGCGTCCAAGCACGAGATAGAA
GGCGCATTTGCCAAATATGGACCCCTGCGAAACGTGTGGGTGGCCCGCAA
TCCACCAGGTTTCGCCTTTGTCGAATTTGAGGATCGCCGTGACGCGGAAG
ACGCAACGCGTGCCCTGGACGGAACACGCTGCTGCGGCACTAGGATTCGC
GTAGAGATGTCTTCGGGTCGCTCGCGCGATCGCCGGCGCGGAGAAGGCGG
CAGTAGTGGTCGCTCTGGTTCCGGACGCTACAGGTCACGTTCGCCACGTC
GCTCCCGATCGCCCCGCAGCCGCAGCTTCTCGCGCGATCGTCGAAGTCGC
TCGGATTCTCGGGATCGTCATTAAAAGCTTTCTAGACCAT

BS26142.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-RA 408 CG17136-PA 1..408 17..424 2040 100 Plus
Rbp1-RD 435 CG17136-PD 1..318 17..334 1590 100 Plus
Rbp1-like-RC 477 CG1987-PC 19..224 35..240 460 81.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-RA 773 CG17136-RA 149..556 17..424 2040 100 Plus
Rbp1-RD 1528 CG17136-RD 149..466 17..334 1590 100 Plus
Rbp1-RD 1528 CG17136-RD 1218..1311 331..424 470 100 Plus
Rbp1-like-RC 1456 CG1987-RC 208..413 35..240 460 81.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10784607..10784925 17..335 1595 100 Plus
3R 32079331 3R 10786155..10786248 331..424 470 100 Plus
X 23542271 X 13384465..13384670 240..35 460 81.6 Minus
Blast to na_te.dros performed on 2014-11-26 16:44:08 has no hits.

BS26142.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:39:44 Download gff for BS26142.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RA 150..555 17..422 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:08:24 Download gff for BS26142.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RA 149..554 17..422 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:26:11 Download gff for BS26142.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp1-RA 149..554 17..422 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:26:11 Download gff for BS26142.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10784607..10784923 17..333 100 -> Plus
3R 10786158..10786246 334..422 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:08:24 Download gff for BS26142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6610329..6610645 17..333 100 -> Plus
arm_3R 6611880..6611968 334..422 100   Plus

BS26142.pep Sequence

Translation from 16 to 423

> BS26142.pep
MPRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFA
FVEFEDRRDAEDATRALDGTRCCGTRIRVEMSSGRSRDRRRGEGGSSGRS
GSGRYRSRSPRRSRSPRSRSFSRDRRSRSDSRDRH*

BS26142.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp1-PA 135 CG17136-PA 1..135 1..135 715 100 Plus
Rbp1-like-PC 158 CG1987-PC 1..158 1..135 591 75.5 Plus
Rbp1-like-PA 158 CG1987-PA 1..158 1..135 591 75.5 Plus
Rbp1-PD 144 CG17136-PD 1..121 1..121 580 90.9 Plus
Rbp1-like-PB 247 CG1987-PB 1..101 1..101 479 88.1 Plus