Clone BS26147 Report

Search the DGRC for BS26147

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:261
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG12607-RC
Protein status:BS26147.pep: gold
Sequenced Size:479

Clone Sequence Records

BS26147.complete Sequence

479 bp assembled on 2011-08-24

GenBank Submission: KX802192

> BS26147.complete
GAAGTTATCAGTCGACATGAAATTCTTTTTGCTATTGGCTTTGGCCCTTG
TGGGCATTGCTGCTGGAGCTCAGCTTCCTGACTCCGCCACCCAGGGACCC
AATCCTCAGGATATTGCCACCCCGGAGCCGGAGTACATTGATATCGACGA
ACCTGCACCGGTGGCTGCCGCACCTGCTCCTCGTCCTGTGGCCGCTGCTC
CCCGTCCCGTCTTCGCCGCCCCTGCTCCCATCGCTCGGCCAGTTGCTCAT
CCAGTGGCTCGCCCCGTGGTTGTGGCCCAATCCTTCGTCCAGCAGCCCGT
CCAGCAGCAGATTGTCCAGAGGGCTCAGTACGTGGCGCCGGTGGCTCAGC
AGGTGGTGTTGCCGCAACAGCAGCTGGTGGGACACACCTACAACAGCAGG
GCTGGATACCAGTACCGCCGTCCAGTCTATGTAAGACGTTTCTATCGCCT
GCGCCGCTACTAAAAGCTTTCTAGACCAT

BS26147.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-RC 447 CG12607-PC 1..447 17..463 2235 100 Plus
CG12607-RD 420 CG12607-PD 1..414 17..430 2070 100 Plus
CG12607-RB 468 CG12607-PB 1..414 17..430 2070 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-RC 1001 CG12607-RC 103..549 17..463 2235 100 Plus
CG12607-RD 794 CG12607-RD 103..516 17..430 2070 100 Plus
CG12607-RB 691 CG12607-RB 103..516 17..430 2070 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4447176..4447620 19..463 2225 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:42:37 has no hits.

BS26147.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:39:42 Download gff for BS26147.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 101..545 17..461 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:43 Download gff for BS26147.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 103..547 17..461 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:25:38 Download gff for BS26147.complete
Subject Subject Range Query Range Percent Splice Strand
CG12607-RC 103..547 17..461 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:25:38 Download gff for BS26147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4447175..4447618 17..461 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:43 Download gff for BS26147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4447175..4447618 17..461 99   Plus

BS26147.pep Sequence

Translation from 16 to 462

> BS26147.pep
MKFFLLLALALVGIAAGAQLPDSATQGPNPQDIATPEPEYIDIDEPAPVA
AAPAPRPVAAAPRPVFAAPAPIARPVAHPVARPVVVAQSFVQQPVQQQIV
QRAQYVAPVAQQVVLPQQQLVGHTYNSRAGYQYRRPVYVRRFYRLRRY*

BS26147.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG12607-PC 148 CG12607-PC 1..148 1..148 757 100 Plus
CG12607-PD 139 CG12607-PD 1..138 1..138 704 100 Plus
CG12607-PB 155 CG12607-PB 1..138 1..138 704 100 Plus