Clone BS26241 Report

Search the DGRC for BS26241

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:262
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptTrx-2-RA
Protein status:BS26241.pep: full length peptide match
Sequenced Size:353

Clone Sequence Records

BS26241.complete Sequence

353 bp assembled on 2011-08-26

GenBank Submission: KX805334

> BS26241.complete
GAAGTTATCAGTCGACATGGTGTACCAGGTGAAAGATAAGGCCGATCTCG
ATGGACAGCTGACCAAGGCATCCGGCAAGCTGGTGGTGCTGGATTTCTTC
GCCACTTGGTGCGGACCCTGCAAGATGATCTCGCCCAAACTGGTTGAGCT
TTCCACGCAGTTCGCCGACAACGTCGTCGTCCTGAAGGTCGATGTGGACG
AATGCGAAGACATTGCAATGGAATACAACATCTCCAGCATGCCCACCTTC
GTGTTCCTCAAGAACGGCGTCAAGGTCGAAGAGTTCGCCGGAGCCAACGC
CAAGCGTCTGGAGGATGTCATCAAGGCCAATATCTAAAAGCTTTCTAGAC
CAT

BS26241.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-RA 321 CG31884-PA 1..321 17..337 1605 100 Plus
Trx-2-RB 321 CG31884-PB 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-RA 790 CG31884-RA 102..424 15..337 1615 100 Plus
Trx-2-RB 1338 CG31884-RB 293..615 15..337 1615 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9615530..9615681 186..337 760 100 Plus
2L 23513712 2L 9615300..9615450 39..189 755 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:11:17 has no hits.

BS26241.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 11:06:08 Download gff for BS26241.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RB 296..614 17..335 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:49:42 Download gff for BS26241.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RB 295..613 17..335 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:53:43 Download gff for BS26241.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RB 295..613 17..335 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:53:43 Download gff for BS26241.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9613517..9613540 17..40 100 -> Plus
2L 9615302..9615448 41..187 100 -> Plus
2L 9615532..9615679 188..335 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:49:42 Download gff for BS26241.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9613517..9613540 17..40 100 -> Plus
arm_2L 9615302..9615448 41..187 100 -> Plus
arm_2L 9615532..9615679 188..335 100   Plus

BS26241.pep Sequence

Translation from 16 to 336

> BS26241.pep
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFA
DNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLED
VIKANI*

BS26241.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-PA 106 CG31884-PA 1..106 1..106 541 100 Plus
Trx-2-PB 106 CG31884-PB 1..106 1..106 541 100 Plus
TrxT-PB 157 CG3315-PB 1..103 1..103 324 59.2 Plus
TrxT-PA 157 CG3315-PA 1..103 1..103 324 59.2 Plus
CG13473-PA 139 CG13473-PA 26..110 19..103 239 45.9 Plus