BS26241.complete Sequence
353 bp assembled on 2011-08-26
GenBank Submission: KX805334
> BS26241.complete
GAAGTTATCAGTCGACATGGTGTACCAGGTGAAAGATAAGGCCGATCTCG
ATGGACAGCTGACCAAGGCATCCGGCAAGCTGGTGGTGCTGGATTTCTTC
GCCACTTGGTGCGGACCCTGCAAGATGATCTCGCCCAAACTGGTTGAGCT
TTCCACGCAGTTCGCCGACAACGTCGTCGTCCTGAAGGTCGATGTGGACG
AATGCGAAGACATTGCAATGGAATACAACATCTCCAGCATGCCCACCTTC
GTGTTCCTCAAGAACGGCGTCAAGGTCGAAGAGTTCGCCGGAGCCAACGC
CAAGCGTCTGGAGGATGTCATCAAGGCCAATATCTAAAAGCTTTCTAGAC
CAT
BS26241.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:11:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Trx-2-RA | 321 | CG31884-PA | 1..321 | 17..337 | 1605 | 100 | Plus |
Trx-2-RB | 321 | CG31884-PB | 1..321 | 17..337 | 1605 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:11:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Trx-2-RA | 790 | CG31884-RA | 102..424 | 15..337 | 1615 | 100 | Plus |
Trx-2-RB | 1338 | CG31884-RB | 293..615 | 15..337 | 1615 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:11:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9615530..9615681 | 186..337 | 760 | 100 | Plus |
2L | 23513712 | 2L | 9615300..9615450 | 39..189 | 755 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 22:11:17 has no hits.
BS26241.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-26 11:06:08 Download gff for
BS26241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Trx-2-RB | 296..614 | 17..335 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:49:42 Download gff for
BS26241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Trx-2-RB | 295..613 | 17..335 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:53:43 Download gff for
BS26241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Trx-2-RB | 295..613 | 17..335 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:53:43 Download gff for
BS26241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9613517..9613540 | 17..40 | 100 | -> | Plus |
2L | 9615302..9615448 | 41..187 | 100 | -> | Plus |
2L | 9615532..9615679 | 188..335 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:49:42 Download gff for
BS26241.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9613517..9613540 | 17..40 | 100 | -> | Plus |
arm_2L | 9615302..9615448 | 41..187 | 100 | -> | Plus |
arm_2L | 9615532..9615679 | 188..335 | 100 | | Plus |
BS26241.pep Sequence
Translation from 16 to 336
> BS26241.pep
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFA
DNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLED
VIKANI*
BS26241.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:55:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Trx-2-PA | 106 | CG31884-PA | 1..106 | 1..106 | 541 | 100 | Plus |
Trx-2-PB | 106 | CG31884-PB | 1..106 | 1..106 | 541 | 100 | Plus |
TrxT-PB | 157 | CG3315-PB | 1..103 | 1..103 | 324 | 59.2 | Plus |
TrxT-PA | 157 | CG3315-PA | 1..103 | 1..103 | 324 | 59.2 | Plus |
CG13473-PA | 139 | CG13473-PA | 26..110 | 19..103 | 239 | 45.9 | Plus |