Clone BS26283 Report

Search the DGRC for BS26283

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:262
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptCG34331-RB
Protein status:BS26283.pep: gold
Sequenced Size:368

Clone Sequence Records

BS26283.complete Sequence

368 bp assembled on 2011-08-24

GenBank Submission: KX802384

> BS26283.complete
GAAGTTATCAGTCGACATGAGCGCAATAAAGCCCGCCCTGCTGCTCTGCC
TGATCCTCACCATCGGTCTGTTCCTTGGTCAAGGTCGGGCGAATCCCGTG
GAGACGAATGTTCCCGATATTCCCGCACCCGATGCCAACGAACTGGGCAT
CGATTTCGGAGAGGAGGAAGATGCCACCGACAAGCCACTGGGCATATTCA
CGATCAAGGTGCGCCACATTCAGCCGGACCCCGCCCACTGCGCCCAGCTC
TCGCCACATCACCCACACCACCCCCAGTGCCACAGCTACTGCAAACGCCA
AGGTCACTGGGTGGGCCAGTGCAAGAAGGACATCTGTCAGTGCTTTTCCT
AGAAGCTTTCTAGACCAT

BS26283.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-RB 336 CG34331-PB 1..336 17..352 1680 100 Plus
CG34331-RC 405 CG34331-PC 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-RB 609 CG34331-RB 28..367 13..352 1685 99.7 Plus
CG34331-RC 599 CG34331-RC 28..223 13..208 965 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20122480..20122819 13..352 1685 99.7 Plus
Blast to na_te.dros performed on 2014-11-26 16:53:20 has no hits.

BS26283.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:39:52 Download gff for BS26283.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 28..363 17..352 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:12:19 Download gff for BS26283.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 32..367 17..352 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:29:50 Download gff for BS26283.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 32..367 17..352 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:29:50 Download gff for BS26283.complete
Subject Subject Range Query Range Percent Splice Strand
X 20122484..20122819 17..352 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:12:19 Download gff for BS26283.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20016517..20016852 17..352 100   Plus

BS26283.pep Sequence

Translation from 16 to 351

> BS26283.pep
MSAIKPALLLCLILTIGLFLGQGRANPVETNVPDIPAPDANELGIDFGEE
EDATDKPLGIFTIKVRHIQPDPAHCAQLSPHHPHHPQCHSYCKRQGHWVG
QCKKDICQCFS*

BS26283.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-PB 111 CG34331-PB 1..111 1..111 624 100 Plus
CG34331-PC 134 CG34331-PC 1..69 1..69 332 95.7 Plus