Clone BS26321 Report

Search the DGRC for BS26321

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptInr-a-RC
Protein status:BS26321.pep: full length peptide match
Sequenced Size:293

Clone Sequence Records

BS26321.complete Sequence

293 bp assembled on 2011-08-24

GenBank Submission: KX804382

> BS26321.complete
GAAGTTATCAGTCGACATGGAGCAGCTATTTCAGAATTACCGCGACGATG
AGCGAAGGATCGGCGAGGAGTATCTGTCAAGTCTCCAGGACCTCAACTGC
AACAGCAAGCCATTGATCAATATGCTCACGATGCTTGCCGAGGAGAACAT
CAACTACGCCCACATCATAGTTAAAGTGGTGGAATATTACATCAGCCAGG
TTAACAAAACAAAAGCGTATTTACTTAAAAACAAAGACACTCCAGCTTAC
ACACAGCTAATAGACGGTCGACACTAAAAGCTTTCTAGACCAT

BS26321.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
Inr-a-RC 261 CG10228-PC 1..261 17..277 1305 100 Plus
Inr-a-RH 5520 CG10228-PH 1..185 17..201 925 100 Plus
Inr-a-RE 5520 CG10228-PE 1..185 17..201 925 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Inr-a-RC 819 CG10228-RC 234..497 17..280 1320 100 Plus
Inr-a-RH 6199 CG86-RH 234..418 17..201 925 100 Plus
Inr-a-RE 5979 CG10228-RE 234..418 17..201 925 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14869968..14870231 280..17 1320 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:58:27 has no hits.

BS26321.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:00 Download gff for BS26321.complete
Subject Subject Range Query Range Percent Splice Strand
Pcf11-RC 233..491 17..275 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:14:34 Download gff for BS26321.complete
Subject Subject Range Query Range Percent Splice Strand
Inr-a-RC 234..492 17..275 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:32:03 Download gff for BS26321.complete
Subject Subject Range Query Range Percent Splice Strand
Inr-a-RC 234..492 17..275 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:32:03 Download gff for BS26321.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14869973..14870231 17..275 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:14:34 Download gff for BS26321.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10757478..10757736 17..275 100   Minus

BS26321.pep Sequence

Translation from 16 to 276

> BS26321.pep
MEQLFQNYRDDERRIGEEYLSSLQDLNCNSKPLINMLTMLAEENINYAHI
IVKVVEYYISQVNKTKAYLLKNKDTPAYTQLIDGRH*

BS26321.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Inr-a-PC 86 CG10228-PC 1..86 1..86 445 100 Plus
Inr-a-PB 573 CG10228-PB 1..62 1..62 317 100 Plus
Inr-a-PH 1839 CG10228-PH 1..62 1..62 317 100 Plus
Inr-a-PE 1839 CG10228-PE 1..62 1..62 317 100 Plus
Inr-a-PF 1850 CG10228-PF 1..62 1..62 317 100 Plus