BS26321.complete Sequence
293 bp assembled on 2011-08-24
GenBank Submission: KX804382
> BS26321.complete
GAAGTTATCAGTCGACATGGAGCAGCTATTTCAGAATTACCGCGACGATG
AGCGAAGGATCGGCGAGGAGTATCTGTCAAGTCTCCAGGACCTCAACTGC
AACAGCAAGCCATTGATCAATATGCTCACGATGCTTGCCGAGGAGAACAT
CAACTACGCCCACATCATAGTTAAAGTGGTGGAATATTACATCAGCCAGG
TTAACAAAACAAAAGCGTATTTACTTAAAAACAAAGACACTCCAGCTTAC
ACACAGCTAATAGACGGTCGACACTAAAAGCTTTCTAGACCAT
BS26321.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:58:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Inr-a-RC | 261 | CG10228-PC | 1..261 | 17..277 | 1305 | 100 | Plus |
Inr-a-RH | 5520 | CG10228-PH | 1..185 | 17..201 | 925 | 100 | Plus |
Inr-a-RE | 5520 | CG10228-PE | 1..185 | 17..201 | 925 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:58:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Inr-a-RC | 819 | CG10228-RC | 234..497 | 17..280 | 1320 | 100 | Plus |
Inr-a-RH | 6199 | CG86-RH | 234..418 | 17..201 | 925 | 100 | Plus |
Inr-a-RE | 5979 | CG10228-RE | 234..418 | 17..201 | 925 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:58:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 14869968..14870231 | 280..17 | 1320 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 16:58:27 has no hits.
BS26321.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:40:00 Download gff for
BS26321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Pcf11-RC | 233..491 | 17..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:14:34 Download gff for
BS26321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Inr-a-RC | 234..492 | 17..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:32:03 Download gff for
BS26321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Inr-a-RC | 234..492 | 17..275 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:32:03 Download gff for
BS26321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14869973..14870231 | 17..275 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:14:34 Download gff for
BS26321.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 10757478..10757736 | 17..275 | 100 | | Minus |
BS26321.pep Sequence
Translation from 16 to 276
> BS26321.pep
MEQLFQNYRDDERRIGEEYLSSLQDLNCNSKPLINMLTMLAEENINYAHI
IVKVVEYYISQVNKTKAYLLKNKDTPAYTQLIDGRH*
BS26321.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Inr-a-PC | 86 | CG10228-PC | 1..86 | 1..86 | 445 | 100 | Plus |
Inr-a-PB | 573 | CG10228-PB | 1..62 | 1..62 | 317 | 100 | Plus |
Inr-a-PH | 1839 | CG10228-PH | 1..62 | 1..62 | 317 | 100 | Plus |
Inr-a-PE | 1839 | CG10228-PE | 1..62 | 1..62 | 317 | 100 | Plus |
Inr-a-PF | 1850 | CG10228-PF | 1..62 | 1..62 | 317 | 100 | Plus |