Clone BS26322 Report

Search the DGRC for BS26322

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptCG42704-RA
Protein status:BS26322.pep: gold
Sequenced Size:392

Clone Sequence Records

BS26322.complete Sequence

392 bp assembled on 2011-08-24

GenBank Submission: KX801428

> BS26322.complete
GAAGTTATCAGTCGACATGAAAATTACCATTGCAATTCTAGGACTTTTTC
TGGCACTTATTTGCAGCCTGGAATCGCCAACCGCAGCGTGCGATATCCAA
GCAGTTTATAATCAAACCTTAAAGTTCTGCGAAAACAACTTCTTTCTGAA
CATATTCTTGTGCACCGGCTTGTCTTACGGTGTCGGCAACGAGAAATTTG
TTCAGACGCTCCAGTCGCAAAGGAAGATCTTGTGTGCAATACCATTTTTT
GCTGAAATTTGCAAAACCTGCGATTTTTCGACGATTGTCTCAAATGATCA
GAATGCTACGATTTCAAGCGGAAATTCAACTGCAGACGCCACCCGAACTT
TGAAGCTTGCCGATCTGACGCGTTAAAAGCTTTCTAGACCAT

BS26322.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42704-RA 360 CG42704-PA 1..360 17..376 1800 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG42704-RA 501 CG42704-RA 20..380 17..377 1805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7412973..7413175 175..377 1000 99.5 Plus
X 23542271 X 7412816..7412907 88..179 460 100 Plus
X 23542271 X 7412687..7412758 17..88 360 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:56:31 has no hits.

BS26322.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:39:57 Download gff for BS26322.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 20..377 17..374 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:39 Download gff for BS26322.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 20..377 17..374 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:09 Download gff for BS26322.complete
Subject Subject Range Query Range Percent Splice Strand
CG42704-RA 20..377 17..374 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:09 Download gff for BS26322.complete
Subject Subject Range Query Range Percent Splice Strand
X 7412687..7412758 17..88 100 -> Plus
X 7412817..7412906 89..178 100 -> Plus
X 7412977..7413172 179..374 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:39 Download gff for BS26322.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7307010..7307205 179..374 100   Plus
arm_X 7306720..7306791 17..88 100 -> Plus
arm_X 7306850..7306939 89..178 100 -> Plus

BS26322.pep Sequence

Translation from 16 to 375

> BS26322.pep
MKITIAILGLFLALICSLESPTAACDIQAVYNQTLKFCENNFFLNIFLCT
GLSYGVGNEKFVQTLQSQRKILCAIPFFAEICKTCDFSTIVSNDQNATIS
SGNSTADATRTLKLADLTR*

BS26322.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42704-PA 119 CG42704-PA 1..119 1..119 609 100 Plus