Clone BS26324 Report

Search the DGRC for BS26324

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:263
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptCG42855-RB
Protein status:BS26324.pep: gold
Sequenced Size:263

Clone Sequence Records

BS26324.complete Sequence

263 bp assembled on 2011-08-24

GenBank Submission: KX800229

> BS26324.complete
GAAGTTATCAGTCGACATGGTCTCCTTTGGCGGTGTGGCAAAACTATTGA
GCAGCTTCGAGTGCTGTGCCAGTTCGTGGGTCAAAGCCGTAAATCCCGGA
TGGTACGAGGCTCGTGAGATTCCGAAGACCATCCTGATCCAGAAAGTGCG
ACAGGTGCCCCAGAATACCAGGGTGATACGCCAGAGACCCCAAACCGCGG
AGCCGCCCAAAAAATCCTCCAGCCAAAAGCGCCAACTTTATCTCTAAAAG
CTTTCTAGACCAT

BS26324.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-RB 231 CG42855-PB 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-RB 945 CG42855-RB 78..308 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18687449..18687679 17..247 1155 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:57:06 has no hits.

BS26324.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-08-24 14:39:58 Download gff for BS26324.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 78..306 17..245 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:13:54 Download gff for BS26324.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 78..306 17..245 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:31:24 Download gff for BS26324.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 78..306 17..245 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:31:24 Download gff for BS26324.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18687449..18687677 17..245 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:13:54 Download gff for BS26324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14574954..14575182 17..245 100   Plus

BS26324.pep Sequence

Translation from 16 to 246

> BS26324.pep
MVSFGGVAKLLSSFECCASSWVKAVNPGWYEAREIPKTILIQKVRQVPQN
TRVIRQRPQTAEPPKKSSSQKRQLYL*

BS26324.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 07:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-PB 76 CG42855-PB 1..76 1..76 394 100 Plus